KEGG   Pseudomonas protegens Pf-5: PFL_3897Help
Entry
PFL_3897          CDS       T00249                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00630  Glyoxylate and dicarboxylate metabolism
pfl01100  Metabolic pathways
pfl01110  Biosynthesis of secondary metabolites
pfl01120  Microbial metabolism in diverse environments
pfl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PFL_3897 (aceA)
Enzymes [BR:pfl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PFL_3897 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AAY93161
UniProt: Q4K9T6
Position
4497339..4498664
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVTRTYSAADVVRLRGSVQPEHTLARMGAEKLWNLVT
QGAKPSFRPDKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNSFRRADQIQWKAGKNPGDDGYIDYFAPIVADAEAGFGGVLNAYELM
KSMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLTAARLAADVAGVPTIILAR
TDANAADLLTSDCDPYDQPFVTGTRTQEGFYKVKAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQILSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHSMFNLAHDYARNDMTAYVKLQEQEFADAAKGYTFVAHQQEVGTGYFDDMTTV
IQGGSSSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagcccttgaaaaagactgggctgaaaacccg
cgctggaaaggcgtgactcgcacctactccgctgccgacgtggtccgtctgcgtggctcg
gttcaacccgagcacaccctggcacgcatgggcgccgagaagctctggaacctggtcacc
caaggtgccaagccgtccttccgtcctgataaagatttcgtcaactgcatgggcgccctg
accggcggccaggctgtacaacaggttaaagccggtatccaggcgatctacctgtcgggc
tggcaagtggctgcggacaacaactccgccgaatccatgtaccccgaccagtcgctgtac
ccggtggactcggttccaaccgtggtcaagcgcatcaacaactcgttccgtcgcgccgac
cagatccagtggaaagccggcaagaacccgggcgacgacggctacatcgactacttcgca
ccgatcgtggccgacgctgaagccggtttcggcggcgtgctgaacgcctacgagctgatg
aagagcatgatcgaagcaggcgccgcaggcgttcacttcgaagatcagctggcttccgtg
aagaagtgcggccacatgggcggcaaggtactggtgccaacccaggaagccgtacagaag
ctgaccgctgcccgtctggcggccgacgttgccggtgtaccgaccatcatcctggcccgt
accgacgccaacgctgccgacctgttgacttccgactgcgacccatacgaccagccattc
gtgactggcacccgcacccaggaaggcttctacaaagtgaaagccggcctggaccaggca
atcgcccgcggcctggcttacgctccgtacgccgacctgatctggtgcgaaaccgccaag
ccggacctggacgaagcccgtcgcttcgccgaggcgatcaagaaggaatacccggaccag
atcctgtcgtacaactgctcgccttccttcaactggaagaagaacctggacgacgcgacc
atcgccaagttccagcgcgaactgtccgccatgggctacaagcaccagttcatcaccctg
gccggcatccacaacatgtggcacagcatgttcaacctggcgcacgactacgcccgcaac
gacatgaccgcctacgtgaaactgcaagagcaagagttcgctgacgccgccaagggctac
accttcgtggctcaccagcaggaagtgggcaccggctacttcgacgacatgaccaccgtg
atccagggtggctcgtcctcggtaaccgcgctgaccggctccaccgaagaagaacagttc
cactga

DBGET integrated database retrieval system