KEGG   Pseudomonas protegens Pf-5: PFL_4247Help
Entry
PFL_4247          CDS       T00249                                 

Definition
aminotransferase (EC:2.6.1.-)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    PFL_4247
   01230 Biosynthesis of amino acids
    PFL_4247
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PFL_4247
   00290 Valine, leucine and isoleucine biosynthesis
    PFL_4247
Enzymes [BR:pfl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PFL_4247
    2.6.1.66  valine---pyruvate transaminase
     PFL_4247
Amino acid related enzymes [BR:pfl01007]
 Aminotransferase (transaminase)
  Class I
   PFL_4247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4943210..4944421
Genome map
AA seq 403 aa AA seqDB search
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPDEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGIGIEDIYLGNGVSELIVMAMQALLNNGDE
VLVPAPDYPLWTAAVSLAGGNPVHYLCDEQANWWPDLADIKAKITPNTKALVIINPNNPT
GAVYPREVLLGMLELARQHNLVVFSDEIYDKILYDDAVHICTASLAPDLLCLTFNGLSKS
YRVAGFRSGWVAISGPKQHAQSYIEGIDMLANMRLCANVPSQHAIQTALGGYQSINDLVL
PPGRLLEQRNRTWELLNDIPGVSCVKPMGALYAFPRIDPKICPIHNDEKFVLDLLLSEKL
LVVQGTAFNWPWPDHFRVVTLPRVDDLEQAIGRIGSFLKSYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagcaaatcgaacaagctcgccaacgtctgttatgacattcgcggcccagtg
ctcaagcacgccaaacgtctggaagaggaaggccaccgcatcctcaagctgaatatcggc
aacccggcgccctttggtttcgaagcgccggacgaaattctccaggacgtgatccgcaac
ctgcccactgcccagggctacagcgactccaagggcctgttcagtgcccgcaaggcggtg
atgcagtactaccagcagaagcaggtggaaggcatcggtatcgaagacatctacctgggc
aacggtgtttccgagctgatcgtgatggccatgcaggccctgctcaacaacggcgacgaa
gtgctggtaccggcccccgactacccgctgtggaccgccgcggtgagcctggccggcggc
aacccggtgcactacctgtgcgacgagcaggccaactggtggccggacctggccgacatc
aaggccaagatcaccccgaacaccaaggccctggtgatcatcaacccgaacaaccccacc
ggcgccgtctaccccagggaagtactgctgggcatgctggagctggcccgccagcacaac
ctggtggtgttctcggacgagatctacgacaagatcctctacgatgacgccgtgcacatc
tgcaccgcctcgctggccccggacctgctgtgcctgaccttcaacggcctgtccaagtcc
tatcgggtagccggttttcgttccggctgggtggccatttccggtcccaagcagcacgcc
cagagctacatcgaaggcatcgacatgctggccaacatgcgcctgtgcgccaacgtgccc
agccagcacgccatccagaccgccctgggcggctaccagagcatcaacgatctggtgctg
cccccgggccgcctgctggaacagcgcaaccgcacctgggaactgctcaacgacattccc
ggggtcagttgcgtcaagcccatgggcgcgctgtatgccttcccgcggatcgacccgaag
atctgcccgatccacaacgacgagaagttcgtcctcgacctgctgctctcggaaaagctc
ctggtggtgcaaggcacggccttcaactggccatggccggatcacttccgcgtcgtgacc
ctgccgcgggtggatgacctggagcaggccattggtcggatcggcagcttcctcaagtcc
taccgccagtaa

DBGET integrated database retrieval system