KEGG   Pseudomonas protegens Pf-5: PFL_4278Help
Entry
PFL_4278          CDS       T00249                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pfl01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4973335..4973940)
Genome map
AA seq 201 aa AA seqDB search
MRVWFLSAGLALMCMAQNAAAGTVLIVGDSISAAFGLDTRQGWVALLEKRLKDQGFNDRV
VNASVSGDTSAGGQARLPALLAEHKPEVVILELGGNDGLRGQPPRQLQQNLASMIDSSQA
QGAKVLLLGMQLPPNYGVRYTQAFSQVYSELASEKKVALVPFFLDGVGGHPELMQADGLH
PAAAAQGKLLENVWPTLKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtatggtttttgagtgccggcctggccttgatgtgcatggcccagaacgcagcg
gcgggtacggtcctgatcgttggcgatagtatcagtgcggctttcggcctggatacccgt
cagggctgggtagccctgctggaaaagaggctcaaggaccagggttttaacgacagggta
gtcaatgcctcggtcagtggtgacaccagtgccgggggccaggcgcggctgccggcgctg
cttgcagagcataagcctgaagtggtgattctcgagttggggggtaacgatggcttgcgc
ggccagccgccccggcaattgcaacaaaatcttgcttcgatgatcgacagctcccaggcc
cagggtgccaaggtgctgcttttaggcatgcaattgccgcccaactatggcgtgcgctat
acccaggccttttcccaggtctacagcgagttggccagcgagaaaaaggtagccttggtg
ccgttttttcttgacggggtcggggggcatcccgaactgatgcaggcagacggtctgcac
cctgcggcagcggcccagggcaagttgctggaaaatgtctggccgacgctaaaaccgctg
ctttga

DBGET integrated database retrieval system