KEGG   Pseudomonas protegens Pf-5: PFL_4278Help
Entry
PFL_4278          CDS       T00249                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PFL_4278
Enzymes [BR:pfl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PFL_4278
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PFL_4278
Lipid biosynthesis proteins [BR:pfl01004]
 Fatty acid synthase
  Component type
   PFL_4278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4973335..4973940)
Genome map
AA seq 201 aa AA seqDB search
MRVWFLSAGLALMCMAQNAAAGTVLIVGDSISAAFGLDTRQGWVALLEKRLKDQGFNDRV
VNASVSGDTSAGGQARLPALLAEHKPEVVILELGGNDGLRGQPPRQLQQNLASMIDSSQA
QGAKVLLLGMQLPPNYGVRYTQAFSQVYSELASEKKVALVPFFLDGVGGHPELMQADGLH
PAAAAQGKLLENVWPTLKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtatggtttttgagtgccggcctggccttgatgtgcatggcccagaacgcagcg
gcgggtacggtcctgatcgttggcgatagtatcagtgcggctttcggcctggatacccgt
cagggctgggtagccctgctggaaaagaggctcaaggaccagggttttaacgacagggta
gtcaatgcctcggtcagtggtgacaccagtgccgggggccaggcgcggctgccggcgctg
cttgcagagcataagcctgaagtggtgattctcgagttggggggtaacgatggcttgcgc
ggccagccgccccggcaattgcaacaaaatcttgcttcgatgatcgacagctcccaggcc
cagggtgccaaggtgctgcttttaggcatgcaattgccgcccaactatggcgtgcgctat
acccaggccttttcccaggtctacagcgagttggccagcgagaaaaaggtagccttggtg
ccgttttttcttgacggggtcggggggcatcccgaactgatgcaggcagacggtctgcac
cctgcggcagcggcccagggcaagttgctggaaaatgtctggccgacgctaaaaccgctg
ctttga

DBGET integrated database retrieval system