KEGG   Pseudomonas protegens Pf-5: PFL_4346Help
Entry
PFL_4346          CDS       T00249                                 

Definition
ARD/ARD' family protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pfl00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(5053899..5054444)
Genome map
AA seq 181 aa AA seqDB search
MSSLSVYHVSSPDLPNKVLTHFDDIAATLAEQGIRFDRWPATTRVAPGTSQQEVICAYQE
QVDRLMTEGGYASVDVISLDEDHPRKAELRASFLDEHRHSEDEVRFFVAGRGLFNLHIDD
YVYAVLCERNDLISVPAGTAHWFDMGERPNLVAIRMFNNPQGWNASLTGDAIASQFPRLD
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcctgtccgtctaccacgtatccagtccggacctgccgaacaaggtcctgacc
cacttcgacgatatcgctgcaaccctggccgagcaggggattcgtttcgaccgctggcct
gccaccacgcgtgttgcaccgggcaccagccagcaagaagtgatatgcgcctatcaggag
caggtcgatcgcctgatgaccgagggtggctacgccagcgtggatgtcatcagcctcgat
gaagaccatccgcggaaggccgagctgcgcgccagctttctcgatgagcaccgccacagc
gaggatgaagtacgtttcttcgttgcgggccggggcctgttcaacctgcacatcgatgac
tatgtgtacgccgtactgtgcgaaaggaatgacctgatctcggtgccggcgggcaccgcc
cattggttcgacatgggcgagcggccgaacctggtggccatccgcatgttcaacaacccc
cagggctggaacgccagcctgaccggcgacgcgatcgccagccagttcccgcgcctggac
gattga

DBGET integrated database retrieval system