KEGG   Pseudomonas protegens Pf-5: PFL_4419Help
Entry
PFL_4419          CDS       T00249                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PFL_4419
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PFL_4419
Enzymes [BR:pfl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PFL_4419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(5129820..5130371)
Genome map
AA seq 183 aa AA seqDB search
MAMRWFAVPALLATLAGSAWAADCPPLLQGSLPKLHAKESIDLCQRFAGKPLVVVNTASF
CGFAPQFKGLEALYQRYKDQGLEVVGVPSNDFKQEAKDGAKTAKVCYVNYGVTFTMTEPQ
KVRGADAVHLFKVLAQQSSAPKWNFYKYVVDRQGNVIASFSSLTKPDNPEFIEAVEKALA
SKS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggctatgcgctggtttgcggttccagctttactcgcgaccttggccggctcggcatgg
gcggcggactgtccgcccctgttgcagggttccttgcccaaattgcacgccaaggaatcc
atcgacttgtgccagcgctttgccggcaagccgctggtggtggtcaatacggcgagcttc
tgcgggtttgctccgcaattcaaaggccttgaggcgctgtaccagcgttacaaggatcaa
gggctggaagtggtgggcgtgccctccaatgacttcaagcaagaggccaaggatggcgcg
aagactgccaaggtctgctacgtcaattacggcgtgaccttcaccatgaccgagccacag
aaggttcggggggcggatgcggtgcacctgttcaaggtgctggcgcagcagagtagcgcg
ccgaagtggaatttctataaatacgtggtggatcgccagggcaatgtgattgccagcttt
tccagcctgaccaagccggacaatccggaattcatcgaagcggtggagaaggcattggcg
tcgaaatcctga

DBGET integrated database retrieval system