KEGG   Pseudomonas protegens Pf-5: PFL_4868Help
Entry
PFL_4868          CDS       T00249                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PFL_4868 (glpK)
Enzymes [BR:pfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PFL_4868 (glpK)
Exosome [BR:pfl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PFL_4868 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
5610807..5612312
Genome map
AA seq 501 aa AA seqDB search
MTDIQNKNYIIALDQGTTSSRAIIFDRDANVVCTAQREFAQHYPQAGWVEHDPMEIFATQ
SAVMVEALAQAGLHHDQVAAIGITNQRETTVVWDKNTGRPIYNAIVWQCRRSTEICQQLK
RDGLEDYIRETTGLVTDPYFSGTKLKWILDNVEGSRERARNGELLFGTIDSWLIWKFTGG
KTHVTDYTNASRTMLFNIHTLEWDAKMLEVLDIPREMLPEVKSSSEIYGRTKSGIAIGGI
AGDQQAALFGQMCVEPGQAKNTYGTGCFLLMNTGDKAVKSQHGMLTTIACGPSGEVAYAL
EGAVFNGGSTVQWLRDELKIINDAHDTEYFAGKVKDSNGVYLVPAFTGLGAPYWDPYARG
ALFGLTRGVRVDHIIRAALESIAYQTRDVLDAMQQDSGERLKALRVDGGAVANNFLMQFQ
ADILGTQVERPQMRETTALGAAYLAGLACGFWGSLEELRGKAVIEREFEPQLAEAEKEGL
YAGWKKAVSRTRDWEPHDEAK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacattcagaataagaactacatcattgccctcgatcagggtacgaccagttcc
cgggcgatcattttcgatcgcgacgccaacgtggtctgcaccgcccagcgcgaattcgcc
cagcattaccctcaggccggctgggtcgaacatgacccgatggaaatcttcgccacccag
agcgcggtgatggtcgaggccctggcacaagccggcctgcatcacgaccaggtggccgcc
atcggtatcaccaaccagcgtgaaaccactgtggtctgggacaagaacaccggccggccg
atctacaacgccatcgtctggcagtgccgccgcagcaccgagatctgccagcagctcaag
cgcgacggcctggaagactacatccgcgaaaccaccggcctggtgaccgacccctacttc
tccggcaccaagctcaagtggatcctcgacaacgtcgaaggcagccgcgagcgtgcgcgc
aacggcgagctgctgttcggcaccatcgacagctggctgatctggaaattcaccggcggc
aagacccacgtcaccgactacaccaacgcctcgcgcaccatgctcttcaacatccacacc
ctggagtgggacgcgaagatgctggaggtgctggacatcccgcgggaaatgctcccggaa
gtgaagtcctcgtcggaaatatatggccgcaccaagagcggcatcgccatcggcggtatc
gccggcgaccagcaggccgcgctgttcggccagatgtgcgtcgagccgggccaggccaag
aacacctacggcaccggctgcttcctgctgatgaacaccggcgacaaggcggttaaatcc
cagcacggcatgctcaccactatcgcctgcggccccagtggcgaagtggcctacgccctg
gaaggcgcagtattcaacggtggttccaccgtgcagtggctgcgtgatgaactgaaaatc
atcaacgacgcccacgacaccgaatacttcgccggcaaggtcaaggacagcaacggcgtg
tatctggtgccggccttcaccggcctgggtgctccctactgggacccctatgcccgtggc
gcgctgttcggcctgacccgcggcgtgcgcgtggaccacatcatccgtgccgccctggag
tccatcgcctaccagacccgcgacgtgctcgacgccatgcagcaggactccggcgaacgc
ctcaaagccctgcgggtggacggcggcgccgtggccaacaacttcctcatgcagttccag
gccgacatcctcggcacccaggtggaacgcccgcaaatgcgtgaaaccaccgccctgggc
gctgcctacctggcgggcctggcctgcggtttctggggcagcctggaagaactgcggggc
aaggcggtgatcgagcgcgagttcgaaccacaactggcggaagcggaaaaagaaggcctg
tacgcaggctggaagaaggccgtcagccgcacccgcgactgggaaccccacgacgaggcc
aaataa

DBGET integrated database retrieval system