KEGG   Pseudomonas protegens Pf-5: PFL_4868Help
Entry
PFL_4868          CDS       T00249                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pfl00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
5610807..5612312
Genome map
AA seq 501 aa AA seqDB search
MTDIQNKNYIIALDQGTTSSRAIIFDRDANVVCTAQREFAQHYPQAGWVEHDPMEIFATQ
SAVMVEALAQAGLHHDQVAAIGITNQRETTVVWDKNTGRPIYNAIVWQCRRSTEICQQLK
RDGLEDYIRETTGLVTDPYFSGTKLKWILDNVEGSRERARNGELLFGTIDSWLIWKFTGG
KTHVTDYTNASRTMLFNIHTLEWDAKMLEVLDIPREMLPEVKSSSEIYGRTKSGIAIGGI
AGDQQAALFGQMCVEPGQAKNTYGTGCFLLMNTGDKAVKSQHGMLTTIACGPSGEVAYAL
EGAVFNGGSTVQWLRDELKIINDAHDTEYFAGKVKDSNGVYLVPAFTGLGAPYWDPYARG
ALFGLTRGVRVDHIIRAALESIAYQTRDVLDAMQQDSGERLKALRVDGGAVANNFLMQFQ
ADILGTQVERPQMRETTALGAAYLAGLACGFWGSLEELRGKAVIEREFEPQLAEAEKEGL
YAGWKKAVSRTRDWEPHDEAK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacattcagaataagaactacatcattgccctcgatcagggtacgaccagttcc
cgggcgatcattttcgatcgcgacgccaacgtggtctgcaccgcccagcgcgaattcgcc
cagcattaccctcaggccggctgggtcgaacatgacccgatggaaatcttcgccacccag
agcgcggtgatggtcgaggccctggcacaagccggcctgcatcacgaccaggtggccgcc
atcggtatcaccaaccagcgtgaaaccactgtggtctgggacaagaacaccggccggccg
atctacaacgccatcgtctggcagtgccgccgcagcaccgagatctgccagcagctcaag
cgcgacggcctggaagactacatccgcgaaaccaccggcctggtgaccgacccctacttc
tccggcaccaagctcaagtggatcctcgacaacgtcgaaggcagccgcgagcgtgcgcgc
aacggcgagctgctgttcggcaccatcgacagctggctgatctggaaattcaccggcggc
aagacccacgtcaccgactacaccaacgcctcgcgcaccatgctcttcaacatccacacc
ctggagtgggacgcgaagatgctggaggtgctggacatcccgcgggaaatgctcccggaa
gtgaagtcctcgtcggaaatatatggccgcaccaagagcggcatcgccatcggcggtatc
gccggcgaccagcaggccgcgctgttcggccagatgtgcgtcgagccgggccaggccaag
aacacctacggcaccggctgcttcctgctgatgaacaccggcgacaaggcggttaaatcc
cagcacggcatgctcaccactatcgcctgcggccccagtggcgaagtggcctacgccctg
gaaggcgcagtattcaacggtggttccaccgtgcagtggctgcgtgatgaactgaaaatc
atcaacgacgcccacgacaccgaatacttcgccggcaaggtcaaggacagcaacggcgtg
tatctggtgccggccttcaccggcctgggtgctccctactgggacccctatgcccgtggc
gcgctgttcggcctgacccgcggcgtgcgcgtggaccacatcatccgtgccgccctggag
tccatcgcctaccagacccgcgacgtgctcgacgccatgcagcaggactccggcgaacgc
ctcaaagccctgcgggtggacggcggcgccgtggccaacaacttcctcatgcagttccag
gccgacatcctcggcacccaggtggaacgcccgcaaatgcgtgaaaccaccgccctgggc
gctgcctacctggcgggcctggcctgcggtttctggggcagcctggaagaactgcggggc
aaggcggtgatcgagcgcgagttcgaaccacaactggcggaagcggaaaaagaaggcctg
tacgcaggctggaagaaggccgtcagccgcacccgcgactgggaaccccacgacgaggcc
aaataa

DBGET integrated database retrieval system