KEGG   Pseudomonas protegens Pf-5: PFL_4885Help
Entry
PFL_4885          CDS       T00249                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
pfl  Pseudomonas protegens Pf-5
Brite
Enzymes [BR:pfl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     PFL_4885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5628349..5629215
Genome map
AA seq 288 aa AA seqDB search
MSKAEIDLGEGSAGFVLGTGPVGVLLIHGLTGTPTELRRVAQGLAKDGTCTVYVPTLPGH
CGDNSDLQATGWQDWYEGVRKTFADVEQRHEQVFVGGLSMGAVMSMYLASEHPGRISGLL
MYSTTLKYDGWSINKLAFLTPLLMKIPFGVHICRFEEKPPYGIKNERLRAIVEKQMKAGE
SSNAGLLTMEGVTVRELHRMNAVVKKRMPSILTPALVLHSSEDDITSTWNADYVERKLGG
PVTKILLDNCYHMITVDLQYQRVIELSADFIQQRVVAPAVREDYRQLA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggctgagatcgatctgggcgaaggcagcgccggcttcgttctcggcacgggt
ccggtcggggtcttgttgatccacggcctgaccggcaccccgacggaactccgtcgggtg
gcccagggcctggccaaggacggtacgtgcacggtgtacgtaccgaccctgcccgggcac
tgcggggacaacagcgaccttcaggccaccggctggcaggactggtacgagggcgtgcgc
aagaccttcgccgatgtagagcagcgccacgagcaggtgttcgtcggcggcctgtccatg
ggtgcggtgatgtccatgtacctggcctccgagcatccgggacggatcagcggcctgctg
atgtactccaccaccctgaagtacgacggctggagcatcaacaagctggccttcctcacc
ccattgctgatgaagatcccctttggcgtgcacatctgccgcttcgaggaaaagccaccc
tacggcatcaagaacgaacgcctgcgggccatcgtcgagaagcagatgaaagccggtgaa
agcagcaatgccgggctcctgaccatggagggcgtgacggtgcgcgaattgcaccggatg
aatgccgtggtcaagaaacgcatgccgtcgatcctgaccccggccctggtgctgcactcc
agcgaagacgacatcaccagtacctggaacgccgactacgtggagcgcaagctcggcggc
ccggtgaccaagatcctcctcgacaactgctatcacatgatcaccgtggacctgcagtac
cagcgggtgatcgaactgagcgcagatttcatccagcagcgagtggtggcacctgcggtg
cgcgaagactaccgacagctggcttga

DBGET integrated database retrieval system