KEGG   Pseudomonas protegens Pf-5: PFL_5183Help
Entry
PFL_5183          CDS       T00249                                 

Gene name
ccpA_2
Definition
(GenBank) cytochrome c551 peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
pfl  Pseudomonas protegens Pf-5
Brite
Enzymes [BR:pfl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PFL_5183 (ccpA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_CBB3 DHOR
Motif
Other DBs
NCBI-ProteinID: AAY94402
UniProt: Q4K673
Position
complement(5942566..5943558)
Genome map
AA seq 330 aa AA seqDB search
MHRCKWLLVFGLLLGGEVRGETPSEPIQPVQPVKITDVAKVELGKQLFFDPRLSKSGFIS
CNSCHNLSMGGSDNLPTSIGHNWHQGPINSPTVLNSGMSIAQFWDGRAATLQEQAGGPIA
NPGEMGFTHDLAVDVLRSIPQYRASFKQVYGDDGIKFDDVTNAIAAFEETLVTPNAPFDR
WLKGDKAAISPSALKGYQLFKSIGCVACHNGEAVGGGSFQKMGMIEPYVTQNPAQGVAGL
TGKDADRMLFKVPTLRNVALTYPYFHDGAYWKLEEAVDVMARLQLGRKLGTEEVSQIVAF
LETLNGDQPDFKLPILPPSSAQTPRPQPFN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgttgtaagtggttacttgttttcggattgctgttggggggtgaggtcaggggg
gaaacgccaagcgaaccgatccagccggtacagccggtgaagatcaccgatgtggccaag
gtggagctgggcaagcagttgttcttcgacccgcgcctgtccaagtccggtttcatatcc
tgcaactcctgccacaacctgagcatgggcggcagcgacaacctgcccacctccattggc
cacaactggcaccaggggccgatcaactcgcccacggtgctcaactccggcatgagcatc
gcgcagttctgggacggccgcgcggccacgcttcaggaacaggccggtggccccatcgcc
aacccgggggagatgggcttcacccatgacctggcggtggacgtgctgcgttccattccc
cagtaccgggcctccttcaagcaggtctacggcgacgacggcatcaagtttgacgacgtg
accaatgccatcgctgcgttcgaagaaaccctggttacccccaatgcgccgttcgaccgc
tggctcaagggcgacaaggcggccatcagcccctccgcgctcaagggctatcaactgttc
aagtccatcggctgcgtggcttgccacaacggcgaggccgtgggcggtggctcattccag
aagatgggcatgatcgagccctatgtcacccagaacccggcccagggcgtggccgggctg
accggcaaggatgccgaccgcatgctgttcaaggtgccgaccctgcgcaacgtggcgctg
acctatccctacttccacgacggcgcctactggaagctggaagaggcggtggacgtgatg
gcccgtctgcaactgggacgcaagctgggtaccgaggaggtcagccagatcgtggccttc
cttgaaaccctgaacggtgaccagccggacttcaagctgccgatcctgccgccgtcctcg
gcgcagacaccgcgtccgcagccgttcaactga

DBGET integrated database retrieval system