KEGG   Pseudomonas protegens Pf-5: PFL_5276Help
Entry
PFL_5276          CDS       T00249                                 

Gene name
folK_1
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pfl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
6042903..6043382
Genome map
AA seq 159 aa AA seqDB search
MERIYIGMGSNLAAPEAQLRSAIEALAQLPESRLHGVSAFYQSDSLLPGQPRYTNAVAAL
DSALAPLALLDALQAIENQQGRERNERWGPRTLDLDILLFGDRLIDEPRLKVPHYHMQAR
PFVLYPLAELAPADLQLADGRTLHELLAACPFVGLERLA
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcatctatatcggcatgggcagcaatctggcagcccctgaagcacaactgcgc
agtgccatcgaggccctagcgcagttgcccgaaagccgcctgcacggcgtatcggccttc
taccagagcgactcattgctcccaggccagccacgctataccaacgccgtcgcggcgctg
gacagcgcgctggcgccgctagccctgctggacgccttgcaggccatcgaaaaccagcaa
ggccgcgagcgaaatgagcgctggggcccacgtaccctggatctggacatcctgttgttc
ggcgatcgactgatcgacgaaccccgcctcaaagtcccccattaccacatgcaggcgcgc
cccttcgtgctctacccgttggcggaactggcccctgccgacctgcaactggctgacggc
cgcaccctgcacgaactgctcgctgcctgcccatttgtcggcctggaacgcctggcctga

DBGET integrated database retrieval system