KEGG   Pseudomonas protegens Pf-5: PFL_5700Help
Entry
PFL_5700          CDS       T00249                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pfl01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pfl00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pfl00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
6496558..6498735
Genome map
AA seq 725 aa AA seqDB search
MTEHVQVGGLQVARVLFDFVNNEAIPGTGLTADSFWAGADKVIHDLAPKNKALLAKRDDF
QARIDAWHQSRAGQAHDAVAYKAFLQDIGYLLPEAADFQATTQNVDEEIAHMAGPQLVVP
VMNARFALNASNARWGSLYDALYGTDAISEADGAEKGKGYNKVRGDKVIAFARAFLDESA
PLTAGSHVDSVSYKIVGGKLVVGLKGGSNSGLRNDAQLIGYQGDAAAPTAILLKHNGLHF
EIQIDATSPVGQTDAAGVKDLLMEAALTTIMDCEDSVAAVDADDKVVIYRNWLGLMKGDL
AEEVSKGGKSFTRTMNADREYTGVNGEPVKLHGRSLLFVRNVGHLMTIDAILDKDGNEVP
EGILDGLVTSLASIHNLNGNTSRKNSRTGSMYIVKPKMHGPEEAAFTNELFGRIEEVLNL
PRNTLKVGIMDEERRTTVNLKACIKAASERVVFINTGFLDRTGDEIHTSMEAGAMVRKAD
MKAEKWIGAYENWNVDIGLSTGLQGRAQIGKGMWAMPDLMAAMLEQKIAHPLAGANTAWV
PSPTAAALHALHYHKVDVFARQAELAKRARASVDDILTIPLAVNPSWTPEQIKNELDNNA
QGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLRHGVVTQEQVLESL
KRMAPVVDRQNASDPLYRPLAPDFDSNIAFQAALELVIEGTKQPNGYTEPVLHRRRREFK
AKNGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcacgttcaagtcggtggcctgcaggtcgccagagtcctgttcgacttcgtg
aacaacgaagccattcccggtaccggcctcaccgccgactcgttctgggccggtgcagac
aaggtcattcacgacctggcgccgaagaacaaagccctactcgccaaacgcgatgacttc
caggcacgtatcgatgcctggcaccagtcccgtgccggccaggcgcatgacgctgtggct
tataaagccttcttgcaagacatcggttacctgctgccagaagcggcggatttccaggcc
acgacgcaaaacgtcgatgaagagatcgcccacatggccggcccgcagttggtggtgccg
gtgatgaatgcgcgcttcgccctcaacgcttccaacgctcgctggggctcgctgtacgac
gccctgtacggcaccgatgccatcagcgaagccgatggtgcggaaaaaggcaaaggctac
aacaaggtccgcggcgacaaggtcatcgccttcgcccgcgccttcctcgatgaatccgcg
ccgctgactgccggctcccacgtggactcggtgagctacaagatcgtcggcggcaagctg
gtggtcggcctcaagggtggcagcaacagcggcctgcgcaacgacgcgcaactgatcggc
taccagggcgacgctgcggcccctaccgcgatcctgctcaagcacaacggcctgcacttc
gagatccagatcgacgccacaagcccggtcggccagaccgacgccgccggggtcaaggac
ctgctgatggaagcggccctgaccaccatcatggactgcgaagactcggtcgccgcagtg
gatgccgacgacaaggtggtgatctaccgcaactggctcggcctgatgaagggcgacctg
gcggaagaagtttccaagggcggcaagtccttcacccgcaccatgaacgccgaccgcgaa
tacaccggggtcaatggcgagccggtgaaactgcacggtcgttcgctgctgttcgtgcgc
aacgtcggccacctgatgaccatcgatgcgatcctcgacaaggatggcaacgaagtgccg
gaaggcatcctcgacggcctggtcaccagcctggcgtcgatccacaacctcaacggcaac
acgtcgcgcaagaacagccgcaccggctcgatgtacatcgtcaagccgaagatgcacggc
cctgaagaagcggcgttcaccaacgagctgttcggccgcatcgaagaggtgctgaacctg
ccgcgcaacaccctgaaagtcgggatcatggacgaggagcgccgcaccacggtcaacctc
aaggcctgcatcaaggcggccagcgagcgcgtggtgttcatcaacaccggcttcctcgac
cgcaccggcgacgaaatccacacctccatggaggccggcgccatggtgcgcaaggccgac
atgaaggccgagaaatggatcggcgcctacgagaactggaacgtcgatatcggcctgagc
accggcctgcaaggtcgcgcgcaaatcggcaagggcatgtgggcgatgccggacctgatg
gcagcgatgctcgaacagaaaatcgctcacccactggccggcgccaacactgcctgggtt
ccatccccgaccgccgctgcgctgcacgcgctgcactatcacaaggtcgacgtattcgcc
cgccaggccgaactggccaagcgtgcccgcgcctcggtggatgacatcctgaccatcccg
ctggcggtcaacccgagctggacgccggagcagatcaagaacgaactggacaacaacgcc
cagggcattctcggttacgtggtgcgctggatcgaccagggcgtgggctgttcgaaagtg
ccggacatcaatgacgtcggcctgatggaagaccgcgccaccctgcgtatctccagccag
cacatcgccaactggctgcgccacggcgtggtcacccaggagcaggtgctcgaaagcctc
aagcgcatggctccggtggttgaccggcagaacgccagcgacccgctgtaccgtcctctg
gcaccggacttcgacagcaacatcgccttccaggccgccctggaactggtgatcgaaggc
accaagcagccaaacggctacaccgagccggtcctgcaccgccggcgtcgcgagttcaag
gccaagaacggtctgtaa

DBGET integrated database retrieval system