KEGG   Pseudomonas protegens Pf-5: PFL_5839Help
Entry
PFL_5839          CDS       T00249                                 

Gene name
proC
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00330  Arginine and proline metabolism
pfl01100  Metabolic pathways
pfl01110  Biosynthesis of secondary metabolites
pfl01130  Biosynthesis of antibiotics
pfl01230  Biosynthesis of amino acids
Module
pfl_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PFL_5839 (proC)
Enzymes [BR:pfl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     PFL_5839 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 NAD_Gly3P_dh_N GFO_IDH_MocA ApbA PDH Shikimate_DH UDPG_MGDP_dh_C DapB_N OTCace DUF169
Motif
Other DBs
NCBI-ProteinID: AAY95029
UniProt: Q4K4D6
Position
6647784..6648602
Genome map
AA seq 272 aa AA seqDB search
MNTTRIAFIGAGNMAASLIGGLRAKGLEASQIRASDPGEQTRAKVAAEHGIQVFADNAEA
IEGVDVIVLAVKPQAMKAVCQALRPSLKPQQLVVSIAAGITCSSMNSWLGAQPIVRCMPN
TPALLRQGVSGLYATAEVSAQQRQQAEELLSAVGIALWLDQEQQLDAVTAVSGSGPAYFF
LLIEAMTAAGEKLGLPRETAAQLTLQTALGAAHMAVSSDVDAAELRRRVTSPAGTTEAAI
KSFQAGGFEALVEKALGAAAHRSAEMAEQLGQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgactcgtatcgcttttatcggtgccggcaacatggcggccagtctcatcggc
ggcctgcgggccaaaggcctggaggcctcgcagatccgcgccagcgacccgggcgagcag
acccgagcgaaagtagcggccgaacatggcatccaggtgtttgccgataacgccgaggcc
atcgaaggcgtcgacgtgatcgtcctggcggtcaagccccaggccatgaaagccgtgtgc
caagccctgcgcccgagcctgaagccgcaacagctggtggtgtccatcgccgccggcatc
acctgttcgagcatgaacagctggctcggcgcccagcccatcgtgcgctgcatgcccaac
accccggcactgctgcgccagggtgtcagcggcctgtacgccaccgccgaagtcagcgcc
cagcaacgccagcaggccgaggaactgctgtccgccgtgggtatcgccctgtggctggac
caggagcagcaactggacgcagtgactgccgtctccggcagtggcccggcgtatttcttc
ctgctgatcgaagccatgaccgccgccggcgagaagctcggcctgccccgggaaaccgcc
gcccagctgactctgcagaccgccctgggcgccgcccacatggcggtctccagtgacgtt
gacgccgccgagctgcgccgccgcgtgacttcaccggcaggcaccacggaagcggccatc
aagtcattccaggccggtggctttgaagccctggtggaaaaagcattgggtgccgctgcg
caccgctcggccgaaatggccgaacaactgggccaataa

DBGET integrated database retrieval system