KEGG   Pseudomonas protegens Pf-5: PFL_5849Help
Entry
PFL_5849          CDS       T00249                                 

Gene name
trmB
Definition
tRNA (guanine-N(7)-)-methyltransferase (EC:2.1.1.33)
Orthology
K03439  
tRNA (guanine-N7-)-methyltransferase [EC:2.1.1.33]
Organism
pfl  Pseudomonas protegens Pf-5
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(6654758..6655483)
Genome map
AA seq 241 aa AA seqDB search
MTESNDTPIQPEAGDERQHRRIKSFVMRAGRMTEGQQRGLDQGAPLYVLPLADAPVDYDQ
VFGRSAPRSLEIGFGMGHSLLEMAAAAPEQDFIGVEVHRPGVGALLNGVLTQGLTNLRVY
DCDAIEVLNRCIADNSLDRLMLFFPDPWHKSRHHKRRIVQASFAELVRSKLKVGGILHMA
TDWEPYAEYMLEVMNVAPGYRNLAEDGKCVPRPAERPITKFERRGERLGHGVWDLKFEKL
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatcaaacgacacgccaatccagccggaagccggcgacgagcgccaacaccgc
cgcatcaagagtttcgtgatgcgcgccgggcgcatgaccgagggccagcagcgcggcctg
gaccagggcgcgccgctgtacgtgctgcccctggccgacgccccggtggattacgaccag
gtgttcggccgttcggcaccgcgctccctggaaatcggcttcggcatgggccactcgctg
ctggaaatggccgcagcggccccggagcaggatttcatcggcgttgaggttcaccgcccg
ggtgtcggcgcgctgctcaatggcgtgctgacccagggcctgaccaacctgcgggtctac
gattgcgatgccatcgaggtgctcaaccgctgcatcgccgacaacagcctggaccggctg
atgctgttcttccccgatccgtggcacaagagccggcaccacaagcgccgcatcgtccag
gcttccttcgccgagctggtgcgcagcaagctcaaggttggcggcattctgcacatggcc
accgactgggagccctatgccgaatacatgctggaggtgatgaacgtcgccccgggttat
cgcaacctggccgaagacggcaagtgtgtaccgcgcccggccgaacgcccgatcaccaag
ttcgagcgtcgcggcgagcgcctgggccacggcgtgtgggatttgaagttcgaaaagctc
gcctga

DBGET integrated database retrieval system