KEGG   Pseudomonas protegens Pf-5: PFL_6054Help
Entry
PFL_6054          CDS       T00249                                 

Gene name
algC
Definition
phosphomannomutase (EC:5.4.2.2 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFL_6054 (algC)
   00030 Pentose phosphate pathway
    PFL_6054 (algC)
   00051 Fructose and mannose metabolism
    PFL_6054 (algC)
   00052 Galactose metabolism
    PFL_6054 (algC)
   00500 Starch and sucrose metabolism
    PFL_6054 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    PFL_6054 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    PFL_6054 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PFL_6054 (algC)
Enzymes [BR:pfl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PFL_6054 (algC)
    5.4.2.8  phosphomannomutase
     PFL_6054 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
6875897..6877294
Genome map
AA seq 465 aa AA seqDB search
MSNAAKVAPKFPDSIFRAYDIRGVVPQTLTAETAYWIGRAIGSQSLAQGEPNVSVGRDGR
LSGPELVAQLIQGLHDSGCHVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSNYNGFK
IVIAGDTLANEQIQALHERLKSNNLSSAQGSVTQVDILPRYAEEIIRDVKLARRLKVVVD
CGNGAAGVIAPQLIEALNCEVIPLFCEVDGNFPNHHPDPGKPENLEDLIAKVKETGADLG
LAFDGDGDRVGVVTNTGSIVFPDRLLMLFAKDVVARNPDAEIIFDVKCTRRLIPLIKEYG
GRPLMWKTGHSLIKKKMKQTGALLAGEMSGHVFFKERWFGFDDGIYSAARLLEILSKEKS
TAEELFATFPNDISTPEINIHVTEESKFSIIDALHDAQWGAGADLTTIDGVRVDYAKGWG
LVRASNTTPVLVLRFEADDAAELQRIKDVFHTQLKRVAPDLQLPF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgcagctaaagtcgccccgaaattccccgacagcatcttccgcgcctacgac
atccgcggcgttgtaccgcaaaccctgactgctgaaaccgcctactggatcggccgcgcc
atcggctcccagagcctggcccagggtgaaccgaacgtctccgtgggccgcgatggccgc
ctgtccgggccggaactggtggcgcaactgatccagggcctgcacgacagcggctgccac
gtcagcgacgtcggcctggtgccgaccccggccctgtattacgcggccaacgtactggcc
ggcaagtccggcgtaatgctcaccggcagccacaacccctcgaactacaacggtttcaag
atcgtcatcgccggcgacaccctggccaatgaacagatccaggccctgcacgagcgcctc
aagagcaacaacctgagcagcgcccagggcagcgtcacccaggtcgacatcctgccgcgc
tacgccgaggagatcatccgtgacgtcaagctggcccgccgcctgaaagtcgtggtggat
tgcggcaacggcgccgccggggtgattgccccacaattgatcgaagccctgaactgcgaa
gtgatcccgctgttctgcgaagtggacggcaacttccccaaccaccacccggatccgggc
aagcccgagaacctcgaggacctgattgccaaggtcaaggaaaccggcgccgacctgggc
ctggccttcgacggcgacggcgatcgtgtcggtgtggtgaccaacaccggcagcatcgtc
ttccccgaccgcctgctgatgctgttcgccaaggacgtggtggcgcgcaacccggatgcg
gagatcatcttcgacgtcaaatgcacccgacgcctgattccgctgatcaaggaatatggc
ggtcgcccgctaatgtggaagaccggtcactcgttgatcaaaaagaaaatgaagcagacc
ggcgctctgctggccggcgaaatgagcggccatgtgttcttcaaggaacgctggttcggc
ttcgacgacggcatttatagcgccgcacggttgctggagatcctcagcaaggaaaaatcc
accgcggaagagctgttcgccaccttcccgaacgatatttctacgccggaaatcaatatc
catgtgaccgaagagagcaaattcagcatcattgacgccctgcacgacgcgcagtggggt
gcaggcgccgacctgaccaccattgacggggtgcgggtcgactatgccaagggctggggc
ctggttcgcgcctccaacaccacccctgtgctggtgctgcgcttcgaggctgatgatgca
gccgaactgcagcgcatcaaggatgtgttccacacccagctgaaacgtgttgcacctgat
ctccaactaccgttttga

DBGET integrated database retrieval system