KEGG   Pyrolobus fumarii: Pyrfu_0007Help
Entry
Pyrfu_0007        CDS       T01620                                 

Definition
(GenBank) hypothetical protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SWIM
Motif
Other DBs
NCBI-ProteinID: AEM37879
UniProt: G0EDP2
Position
complement(5487..6137)
Genome map
AA seq 216 aa AA seqDB search
MPDAVRGEAVAKLDKLAEYLYKLSERFFGDDAPRVKEYISKRVSGARDVIIHASERIVSV
RRVGDNAHVILMVSAKYAGKGVRLQPVAVRTLDGRVRLQPPEAVETIYHVEIGPYALKCT
CPDAIFTGASADRVLARLGFPPQAYKYTLCKHVLAGIALLWAMGLVDPTKPPMDEALLRG
LVTAYLATLPPGAKPRISRIALVYTRGETSTPLTLN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
ttgccagacgcggtgcgaggcgaggcagtggccaagctggacaagctagctgagtatctg
tacaagctttccgagcgcttctttggtgacgatgcgccgcgtgtgaaagagtatatctcg
aagagggttagtggcgcgcgtgacgtgataattcacgcgtcggagcgtatcgttagcgta
aggcgggtgggagataacgcccacgtgatactcatggtgtcggcgaagtatgcgggcaag
ggagtaaggcttcaaccagtggcggttcggacgcttgacgggcgtgttaggcttcagccg
ccagaggccgtggagacgatataccacgttgagatagggccctatgccctcaagtgtacg
tgccccgacgcaatattcacgggtgcaagcgcggatagggttcttgcgaggctaggtttc
cctccacaagcctacaagtacactctatgtaaacatgtacttgccgggatagcgctacta
tgggcaatgggtctcgtcgatccaacgaagccgccgatggacgaggcgcttctccggggc
ttggtcaccgcttacctggcgacactacctcccggcgcgaagccaaggatctcgcgaata
gctctagtatacacgagaggcgagacaagcacaccgctgacgctcaactag

DBGET integrated database retrieval system