KEGG   Pyrolobus fumarii: Pyrfu_0018Help
Entry
Pyrfu_0018        CDS       T01620                                 

Definition
(GenBank) hypothetical protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Herpes_UL3 zf-PHD-like
Motif
Other DBs
NCBI-ProteinID: AEM37890
UniProt: G0EDQ3
Position
complement(15017..15418)
Genome map
AA seq 133 aa AA seqDB search
MVRAVLTGIVMAFVYAGVGIAPLVYTYLTARRARREYEREIEEAVSEPIVPVHVVVIVKE
DDVEARLVNAATASSMDELVANSLVEMHSDDNAEGETSTEEGGILVPLATIGPQLEGVKA
PMATSVQGVQEYV
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgtgcagtgctcactggtatagtgatggcgtttgtctatgccggtgtcggtata
gcgcctctcgtgtacacgtatctcaccgctagacgtgctaggagggagtacgagcgcgag
atagaggaggcggtctcggagcctatcgtccccgtgcatgtagtagtgatcgtgaaagag
gatgatgtggaagcgcggctagtcaacgcggctaccgctagcagtatggacgaacttgta
gctaacagccttgtcgagatgcacagtgatgataacgcagagggtgagaccagtacagag
gagggcggtatactcgtgcctctagcaactattgggccgcagcttgaaggtgtaaaggcg
ccaatggctacgagtgtccagggtgttcaggaatacgtctag

DBGET integrated database retrieval system