KEGG   Pyrolobus fumarii: Pyrfu_0022Help
Entry
Pyrfu_0022        CDS       T01620                                 

Definition
(GenBank) hypothetical protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEM37894
UniProt: G0EDQ7
Position
17957..18304
Genome map
AA seq 115 aa AA seqDB search
MSSGQGQTSTRTKISEKELEKIMSQLIEQESKAKDPKKKWVTRMLRSAKMYHKMCPYYDK
RTGKCFIKMGGKCERDGKFDGCPVFIEWLSKKYDELTQKGVPLPMDFQDLVLLAV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctcgggacaggggcagacctctaccaggactaagataagcgagaaggagctcgag
aagataatgtcgcagctaatagagcaggagtctaaggccaaggacccgaagaagaagtgg
gtcactaggatgctaagaagcgcaaagatgtaccacaagatgtgcccatactacgacaag
aggacgggcaagtgcttcataaagatgggcgggaagtgcgagagggatggaaagttcgac
ggctgcccagtgttcatagagtggctgtccaagaagtacgacgagctgacacagaagggt
gtaccgctaccaatggacttccaggatctcgtgcttctcgccgtataa

DBGET integrated database retrieval system