KEGG   Pyrolobus fumarii: Pyrfu_0030Help
Entry
Pyrfu_0030        CDS       T01620                                 

Definition
(GenBank) hypothetical protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_2 Fer4_9 Fer4_16 Fer4 Fer4_4 Fer4_6 Fer4_18 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AEM37902
UniProt: G0EDY6
Position
23295..24521
Genome map
AA seq 408 aa AA seqDB search
MHVRRNIVKFSFLRCNNGLSRMDKQLVNDYVNSAASYAREATRVCSRCGLCLSACTVYMS
TRDPRLSPMSRLRAAAKVLNGGSFTDDDVLALYTCNQCGACTQVCPYAIEVLRVVHAARI
VLASKGVYPEGLRKVSESARRAGHSFTPNREEPVKLLVEIAREVGIKPDESADILYVPSP
FETTVYPHVLRDTLLLFKKLGLSVTVSTRALDSGGNVAIDANDLEAGFMLLKACVEEAER
LGARTVLLSQCGADTKLVILLYKLGVRLGGPRVANIYEFFAERGFRATCTNCILFTSCTF
ARLDPKRSLEKTIVARKPRDKPPYTMCCGGAGGLNFLHEEPFASIRKRVYRWRFERLLKS
AKGATIVLPCVKCYSVLRHGALLAKKPTYPMKMYTSVALEEVSSASQP
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
ttgcacgtccggcgaaatattgtaaaatttagttttctccggtgcaacaacgggctgtca
cgcatggataaacaactagtgaacgactacgtcaatagtgccgctagctacgcaagagag
gctacgcgcgtctgctcgcggtgcggtctttgcctctccgcgtgcacagtctacatgtct
acacgtgatccccgcctctccccgatgtcccgcctgagagccgcagcgaaggtactgaac
ggcggtagtttcaccgatgatgacgtgttagcactctacacttgtaaccagtgcggtgca
tgcacacaggtatgcccctatgctatagaggttctcagggtggtgcacgccgctaggata
gtactggcgagtaagggcgtctatccagagggtctgaggaaggtatccgagtctgcaagg
agggctgggcacagcttcacgcctaaccgcgaagagcctgtcaaactactcgttgagata
gcaagagaggttggcataaagccagatgagagtgcggatatactctacgtgcctagcccg
ttcgagacgaccgtatacccacacgtattgagggacactctccttctcttcaagaaactt
gggctaagcgtcacggtctctacaagggcgctcgatagtgggggaaacgtcgcgatagat
gctaacgatctcgaggctggctttatgctactaaaagcttgtgtcgaggaggctgagcgg
cttggcgctcgcacagtgctactatcccagtgtggcgccgataccaagctggtcattctc
ctctacaagcttggtgttcgcctagggggtccgagggtcgcaaacatatacgagttcttt
gcggagaggggcttccgcgctacatgcaccaattgcatccttttcacaagctgcaccttt
gccaggctagaccctaagaggagccttgagaaaaccatcgttgcccgcaagcctcgcgac
aagccgccctacactatgtgctgtggtggtgcgggtggcctgaacttcctgcacgaggag
ccattcgcgagcataaggaagagagtgtaccggtggaggttcgagaggctattgaagagc
gcaaagggcgctacgatagtattgccgtgcgtcaagtgctatagcgtgttgaggcacggg
gcgctactggcgaagaagccaacataccccatgaagatgtatacgagcgtggcgttggag
gaggttagctcagcgagccagccctaa

DBGET integrated database retrieval system