KEGG   Pyrolobus fumarii: Pyrfu_0036Help
Entry
Pyrfu_0036        CDS       T01620                                 

Definition
(GenBank) hypothetical protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEM37908
UniProt: G0EDZ2
Position
32257..32568
Genome map
AA seq 103 aa AA seqDB search
MHKTLPLIEEIARSTPNLEEFARELIRTGYIAYTTHIRLPKRHPRIGTRIRALAVYVGRH
LEAIAVKADGLGAEDLKMLSDTLGVPVVAFDSNGARVYHASSA
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagacactacctcttatcgaagaaatagctaggagcacgcccaacctcgaagag
tttgcacgcgaactcatccgcaccgggtacatagcctacacaacacacatccgcctacca
aagaggcacccgaggataggcacgcgcatacgcgcactagccgtgtacgtcggcaggcac
ctggaggcgatagcagtcaaagcagatggacttggagcagaggatctcaaaatgctctca
gataccctcggcgtaccagttgtagcattcgattcaaacggagcaagagtctatcatgca
agcagcgcataa

DBGET integrated database retrieval system