KEGG   Pyrolobus fumarii: Pyrfu_0048Help
Entry
Pyrfu_0048        CDS       T01620                                 

Definition
(GenBank) uncharacterized conserved protein UCP008210
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2153 DUF1912 Cas_Cmr3
Motif
Other DBs
NCBI-ProteinID: AEM37920
UniProt: G0EE04
Position
40755..41174
Genome map
AA seq 139 aa AA seqDB search
MQRVIDYGFLRNLDEWVRMQKKVLETFQKVEKDVEEGDRLQLILATRAAFQHMMRTIKAF
DHWLQDPVIISHITREMLIEVWQVMYKVLTELLEIDIKHTSEMRQLLEKLAREGKLNPLA
AAVKSEEEEEQRRPPTLSV
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcgtaatagactatggctttctacgcaatcttgacgagtgggttaggatgcag
aagaaggtgctagagacgttccagaaggtcgagaaggatgtcgaggagggcgacaggcta
cagctgatactagccactagggcagcgttccagcacatgatgaggaccatcaaggcattc
gaccattggctgcaagaccctgtcatcattagccacataacaagggagatgctaatcgag
gtctggcaggtgatgtacaaggtacttacagagcttctcgagatagacatcaagcatacc
agcgagatgcgccagttgctcgagaagctggcacgcgaaggtaagctgaacccgctagcc
gcggccgtcaagagcgaagaggaggaagaacagaggaggccaccaacgctatcagtctaa

DBGET integrated database retrieval system