KEGG   Pyrolobus fumarii: Pyrfu_0051Help
Entry
Pyrfu_0051        CDS       T01620                                 

Definition
(GenBank) prefoldin, beta subunit
  KO
K04798  prefoldin beta subunit
Organism
pfm  Pyrolobus fumarii
Brite
Chaperones and folding catalysts [BR:pfm03110]
 Heat shock proteins
  GimC
   Pyrfu_0051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prefoldin_2 FliJ Prefoldin Spc7 DUF2884 DUF4407 Pox_F11 FlaC_arch HD_3 Spc24 Caps_synth_GfcC PP2C_C DUF2913 ZapB SlyX NYD-SP28_assoc CorA
Motif
Other DBs
NCBI-ProteinID: AEM37923
UniProt: G0EE07
Position
complement(42710..43105)
Genome map
AA seq 131 aa AA seqDB search
MAQRLPPELESKVAEAQRLQEQLNRVVQERVALESEKSEIERVLKLLEEVQENEVYRSVG
GILVRVSKEKVANELKDRLELIDIRLEKLRKQENELRKRLEQLLREIREYQVRLQAGTSV
KPEQLGKKGGG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
gtggctcagaggcttccacccgagcttgagagtaaggtagcagaggctcagaggctccaa
gagcagctcaacagagtcgtgcaggagagggttgcgctcgagagtgagaagagcgagata
gagagggtcttgaagttgctcgaggaggtgcaggagaacgaggtttatcgtagcgttggc
gggatactcgtgagggtgtcgaaggagaaggttgccaacgagttgaaagacaggctcgag
cttatcgacattaggcttgagaagctaaggaagcaggagaacgagctgcggaagaggctt
gagcagcttctacgcgagatacgtgagtatcaagtgaggctccaggcgggcactagtgtt
aagccagagcagctcgggaagaagggtggcgggtga

DBGET integrated database retrieval system