KEGG   Pyrolobus fumarii: Pyrfu_0053Help
Entry
Pyrfu_0053        CDS       T01620                                 

Definition
(GenBank) sodium/hydrogen exchanger
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger CBS
Motif
Other DBs
NCBI-ProteinID: AEM37925
UniProt: G0EE09
Position
43740..45287
Genome map
AA seq 515 aa AA seqDB search
MAGSEIALVAVYVGLVLLVAKLFEDIVRRARLPGFIGAIIAGYILGPGGLNIIHKEHVEA
MGLLLVVGIDFLLFLAGAEELSRMRGGLRPRELSVATVLMLSTTAATAVVAHLLYREHLD
WSTSLAFGIVMAIVSLGPLTRALIDSGLIATNAGLTVTRIGLIAEVGGILAFNAVYAGKI
FPNAITTPLFFIAVYLFGRRLLTRILYLVEDVISAREAPFAIIVALVLTASYLAEIIGFN
AAVTALLLGFFASTYLEERPAYVERLKAFTYGFLEPLFFAGIGLKVPQLDPSSMAAMLLI
TLAAAAPKLLTASAAGLMPTGIALLAKGGVDAALLLTLYETPHGKGNLIPDQLYTAGVFS
MLLLSTLMALGLRSIQPPRAKGEKEPWRMRIGELGLGYDVVRRTDNLLTVSMFVSASQGG
AVVVIDEDGRPIGYITAADLIYIAPSEMRRLTAEEVMRENVPIVKVTDRVTELLREHLVA
EPIVAVVDEDGHLVGTLNPHRVLQKIYGISGKREH
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
ttggctggcagcgagattgcactcgtagcagtatatgtcggtctcgtgctgcttgtcgct
aaactcttcgaggatatcgtgaggagagccaggctgccaggcttcatcggcgctattatc
gccggctacatactaggccccggcggcctgaacatcatacacaaggagcatgtcgaggcc
atgggtctgcttctagtcgtgggtatagactttctactgttcctcgcaggcgctgaagag
ctaagcaggatgaggggcggcttacgtccacgcgagttgagcgtagctaccgtcctcatg
ctctcaactacagccgctactgccgtagtagcccacctcctctaccgcgaacacctggat
tggagcacatcgctagcctttggcatcgtcatggcaattgtgagcctcgggccattaaca
cgcgcgttgatagactcggggttgatagccacgaatgctggcttgacggtaacgcgcatc
ggcttaatagctgaggtcggcggcatactcgcgttcaacgccgtctatgcgggcaagata
ttcccgaacgccattacaacaccactcttcttcatagcggtctacctcttcgggcggcga
ctgctaacccgcatactctacctggtcgaggatgtgatctcggctcgcgaagctcccttc
gcgataatagtcgcgttggtcctcacggctagttacctagcagagataatagggttcaac
gcggctgttactgcactactcctaggcttcttcgcgtcgacttatctcgaagagaggcca
gcatacgtagagaggctcaaggcgttcacatatggcttcctcgagccgctgttcttcgct
ggtatcggcctaaaggtaccacaactagatccttcgagcatggcagcaatgctcctcata
acactagctgccgccgctcccaagctgcttacagcgtcagccgccgggctaatgccaact
ggtatagccctcctggcgaagggtggcgttgatgccgcgctcctcttaacgctatacgag
acgccacacggcaaaggtaacctgatacccgaccagctttacaccgccggcgtcttctca
atgctactcttaagcacactcatggctctcggcctgcgtagcattcagccgccacgcgca
aagggcgagaaagagccttggaggatgaggattggagaactcggcctcggatacgacgtc
gtaagacgcacagacaacctattgacagtctcgatgttcgtaagtgctagccaaggcggc
gcagtagtcgttatagacgaggatggacgccccataggctacatcacagcagctgacctc
atctacatcgcaccatcagaaatgaggaggttaacggcggaggaggtcatgagggagaat
gtgccaatagtgaaggtaactgatagagtaacagaactactacgtgagcatctcgtggca
gagccgatagtggcggtggtcgacgaggacggccacctcgtaggcacgctgaatccgcac
cgtgtgctccagaagatatacgggattagcggtaagcgcgagcactag

DBGET integrated database retrieval system