KEGG   Pyrolobus fumarii: Pyrfu_0087Help
Entry
Pyrfu_0087        CDS       T01620                                 

Definition
(GenBank) 4-vinyl reductase 4VR
  KO
K07013  uncharacterized protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: V4R Hydantoinase_A
Motif
Other DBs
NCBI-ProteinID: AEM37959
UniProt: G0EE43
Position
complement(76175..76675)
Genome map
AA seq 166 aa AA seqDB search
MAVVQVDEDLRKKLDGVVLNESIMIARDVIVDLYTAFEKFMRFAGPVLYNAAKKAGRLMA
QRLMERGVIDESNALDALLWSFVRAGYASEVKVLEDKVEKNKRVIRIGMKGTLLGAKIQR
KKPVDAPLAGFAAGWLEAVWGKKVDAKEVACLAKGDDMCVFEIVVK
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
gtggctgtggtgcaggtggatgaagatctgagaaagaagctggatggcgtggttctcaac
gagagcattatgatagcgcgtgacgtcatagttgacctgtatacggcgtttgaaaaattc
atgaggtttgcgggtccggtgctatacaatgctgccaagaaggctggtaggctcatggcg
caaaggcttatggagaggggcgtgatagacgagtcaaatgctcttgatgcgctcctctgg
agctttgtcagggccgggtatgcgagtgaggttaaggtccttgaggataaggttgagaag
aacaagcgcgtgatcaggatagggatgaaggggacgctgctaggtgctaagatacagaga
aagaagccggtagatgcgcctcttgcgggtttcgcggcagggtggcttgaggctgtgtgg
ggcaagaaggtggatgccaaggaggtagcgtgcctcgctaagggcgacgatatgtgtgtg
tttgagatcgtcgtcaagtag

DBGET integrated database retrieval system