KEGG   Pyrolobus fumarii: Pyrfu_0097Help
Entry
Pyrfu_0097        CDS       T01620                                 

Definition
(GenBank) hypothetical protein
  KO
K06869  uncharacterized protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAC2 Vac_Fusion
Motif
Other DBs
NCBI-ProteinID: AEM37969
UniProt: G0EE53
Position
90336..91094
Genome map
AA seq 252 aa AA seqDB search
MAELVFAHRRVRVYAIDPGALSEAARDGVLITGFRGFGAVGYITTTHLVEKLRLQRLGYI
VTRYMPEFVTRGADGGIVAPFEIYGSVERRLLVLVNHDVPVERERDAYAEAVVLFAKKMG
VSRGVFIGGFDARFRRGEERFRWLASGGYQGEFSEPTIDKDLFVVGPLALLILYSEIHRF
PAVTILPYTETARPDPAAAAVAVEVVARLLNLEVDVSELLEMARKIEEVIERVEHQREAA
TAPSGASDRLYT
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctgagctcgtgtttgctcatcgccgggttagggtatacgctatcgacccgggtgcg
ttgagcgaggccgctagagacggggtgttgataactggtttcagggggttcggggctgtc
gggtacatcactaccacgcatcttgtggagaagcttagactacagagactgggatacatc
gtcaccaggtatatgccagagtttgtgacgcggggtgccgacggggggatagtcgcgcct
ttcgagatatacgggtctgtcgagaggaggctattggtgctcgtcaaccacgatgtaccc
gttgagagggagagggatgcgtacgcagaggccgtagtcctctttgctaagaagatgggc
gtgtcgaggggcgtattcatcggcgggtttgacgcgaggtttcgtaggggtgaggagagg
ttccgctggctcgcttctggcggctatcagggcgagtttagcgagccaacgatagacaag
gacttgttcgtggtgggtcccctggcgctcctcatactctactcggagattcaccggttc
cccgcagtcacgatactaccctacactgagactgcgaggccggacccggctgcagctgct
gtggccgttgaggtcgttgctaggctgctaaacctggaggttgacgtgagtgagttgctc
gagatggctaggaagattgaggaggtcatagagagggtcgagcatcagcgcgaggctgct
actgcgccaagcggggctagcgacaggctctacacttga

DBGET integrated database retrieval system