KEGG   Pyrolobus fumarii: Pyrfu_0123Help
Entry
Pyrfu_0123        CDS       T01620                                 

Definition
(GenBank) hypothetical protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEM37995
UniProt: G0EEF4
Position
112510..113016
Genome map
AA seq 168 aa AA seqDB search
MSRNGQPAMLGDYYRVLGIAEQPKVEHGPNGVLYYWFEVFRRATLTPSKFPCWHITLDVY
VEGYPGICITRMNNIVSINDSRIHYCDLSMLLRPVCSHINNAWIEILEVEGSIETISIHI
DICGFAEPPPYELVEAIHNAATMLIERRDPRSTPLWIDVKHLMQYKRA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgaaacgggcagcccgccatgctcggtgactattatcgggttctcggtatagcc
gaacaacccaaggtggaacatgggccgaatggcgtcctttattactggtttgaggttttt
aggcgagcgacgctgacgccgtccaagttcccttgctggcatataacgttggatgtgtac
gtggagggataccccggaatatgcataacccgcatgaacaacatagtttcgattaacgac
tccaggatacattactgcgatctgtctatgctccttagaccggtgtgtagccacataaat
aacgcgtggatcgagatactcgaagtagaaggtagtatagaaacaatctcaatacacatt
gacatatgtggcttcgcagagccaccaccatacgagcttgtagaggctatacacaacgct
gccaccatgttgatagagagacgagacccgcgctctaccccattatggattgacgtaaag
cacctaatgcaatataagcgggcatag

DBGET integrated database retrieval system