KEGG   Pyrolobus fumarii: Pyrfu_0142Help
Entry
Pyrfu_0142        CDS       T01620                                 

Definition
(GenBank) phosphoadenosine phosphosulfate reductase
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAPS_reduct Diphthami_syn_2 NAD_synthase QueC ATP_bind_3
Motif
Other DBs
NCBI-ProteinID: AEM38014
UniProt: G0EEH3
Position
126263..127726
Genome map
AA seq 487 aa AA seqDB search
MLTVALANGVLEAVMVHQEWKPVTPSKPPYLILVRAGKDRDATRAAVNRFYDGWGIVVES
LGGTRDPEEAYERARSILREDQAHFVMYIGGREDAELVEKLDASIVDERFAAISIGKKRV
RNARLEEIFWGIERARAKLRLRVGLDGDKILVHRVPRDKLLSDLVVDQPFADVFIGGRGW
VKWLSKLGACLPDTELVILERLAGGRHLVYDGLTPCCELHMPDEGIPSVTNVNCENRREY
GLQYNSLLNTNNYTVTESFERISLSLLRDALARAEEVLGYVDAIVVPWSGGKDSTMALYL
AVKAYGASRVVAIYVDTGVDFPQNIDYINDLASRLGIEVVKARAPVREFIPLKGMPRHDY
RWCTGLKLETLESVLRRLGEKLVVVTGDRDAESEPRSRRPLMRVEESEHVKRLIVTPLKQ
WSTILLQLYAKVRGLELNPLYELGFYRLGCYICPALRSWEKLILAREPLVAARLVGLPYY
RRGLRQG
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
ttgctgactgttgcactagcgaatggggtcttagaggctgtcatggtacatcaagagtgg
aagcccgtaacccccagcaaacccccatatctcatactcgttagagccggtaaggatcgt
gatgctacacgcgccgctgtaaatagattctatgacgggtggggcattgtagttgagagt
cttggcggtactcgcgatcctgaagaggcatatgagagggcaagaagcatacttagagag
gatcaggcacacttcgtaatgtacattggtggtcgtgaggatgcagaacttgtagagaag
ctagacgctagtatagttgatgagaggttcgcggcgataagcattggtaagaagcgcgtt
agaaatgccaggcttgaagagatattctggggtattgagcgggcccgtgcaaagttacga
ctacgtgtcggcctagatggcgacaaaatacttgtccatcgagtgcctcgcgacaaactg
cttagtgatcttgtggttgaccagccattcgccgacgtgtttataggcggacgcgggtgg
gtcaagtggctctcaaagctaggtgcgtgtttaccggacacggagcttgttatactcgag
cgtcttgctggtggaagacacctagtctatgacgggctaaccccttgttgcgagcttcac
atgccggatgagggcattcctagcgtgactaacgttaattgcgagaataggagagaatat
gggcttcaatacaactcgctgctcaacactaacaattacacagtcactgagagctttgag
cgtatatcactgtctttgctaagagatgcactggcacgtgccgaagaggttctgggttac
gtggatgctatcgttgtaccatggagtggtggaaaagattccacaatggccctctatctc
gcggtcaaagcttatggtgcatcccgcgtagtcgcaatttacgttgatactggcgtggat
ttcccacagaacatagattatatcaatgatctcgcctctaggcttggcatcgaggttgta
aaggcacgtgcacctgtacgtgaattcataccgctgaagggcatgccgcgccatgattat
cgttggtgtactggtttgaagcttgagactctggagagcgtgctgagacgcttgggcgag
aagctggtagtcgtcacgggcgatagggatgcggagtccgagccacgtagccgcagacca
ctgatgcgtgtagaggagagtgaacatgtgaaacgtctaatagtcactccacttaagcag
tggtcgactatactgctacagttatatgccaaggtgcgcggtttagagctaaacccgcta
tatgagcttggattttacaggctaggttgctacatatgccccgcgctacgctcgtgggag
aaactcatacttgcacgtgagcctctggttgcagccaggctcgttggactgccctattat
aggaggggcctcagacaaggctga

DBGET integrated database retrieval system