KEGG   Pyrolobus fumarii: Pyrfu_0144Help
Entry
Pyrfu_0144        CDS       T01620                                 

Definition
(GenBank) hypothetical protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4142 DUF2710 Ferritin DUF1451
Motif
Other DBs
NCBI-ProteinID: AEM38016
UniProt: G0EEH5
Position
129043..129405
Genome map
AA seq 120 aa AA seqDB search
MSRIEEFAGLLRKRGYQVESSDSVVIARHPSAPISLEVRLEKDTLYLRLKYSDIRDYIDD
LREAESDESAKEFIEEVLDDLSEAANQLEVLARQKGIRVQSTVKRDVLDILEALEDILES
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
ttgtcccgcatagaagagttcgccggcttattacgcaagcgaggctaccaggtggaatct
agcgattctgtcgtcatagctcgtcatccttcggctcccattagcctcgaggtccggtta
gagaaggataccttgtatctacgtctaaagtatagtgatatacgcgattacatcgatgat
ctccgtgaggcggagagtgacgagagtgccaaagagtttatagaggaggttctagacgat
ttgagtgaagctgcgaaccagttggaagtacttgcacgccagaagggtatacgcgtacaa
tccactgtaaaacgcgatgtcttggatatactagaggcactcgaggatatactcgagtct
taa

DBGET integrated database retrieval system