KEGG   Pyrolobus fumarii: Pyrfu_0146Help
Entry
Pyrfu_0146        CDS       T01620                                 

Definition
(GenBank) tRNA (guanine-N1-)-methyltransferase
  KO
K15566  tRNA (adenine9-N1/guanine9-N1)-methyltransferase [EC:2.1.1.218 2.1.1.221]
Organism
pfm  Pyrolobus fumarii
Brite
Enzymes [BR:pfm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.218  tRNA (adenine9-N1)-methyltransferase
     Pyrfu_0146
    2.1.1.221  tRNA (guanine9-N1)-methyltransferase
     Pyrfu_0146
Transfer RNA biogenesis [BR:pfm03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    Pyrfu_0146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: AEM38018
UniProt: G0EEH7
Position
130797..131894
Genome map
AA seq 365 aa AA seqDB search
MKILRYNTVCENECLFYKLLRLLNEYGWYNLGLGAWIKSRRIRDNGFQEVALRVLVWSGV
VGEASRIKGGIDQVLNYQGREYRFVFGPGDVKADAAYYQHRCKSSYCIEHDDIVSLLPEK
PKPLIVIDLAQLHMHNLDEASSLRRQLAATLGVIRRFLWDRHLLLTNAAEGVRAWLKSFM
ATMQVQMSSLNTDDALDVRGYTGLRILLDPNADKDLQPDEVVKADVFILGGIVDKRPRPG
ATRELPIEGAVRRRISLRGSIIGVPHTINTLVEALLLARYVYDGNIERALYDVTPPHEAR
IRAYVEISRVIRGAKGAYVDWDLYEELVKWLPLRPRDFEKAARMAGARLRRSYEEYLLSK
DQSHH
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatattaaggtataacacggtatgcgagaatgaatgcctcttctataagttgctt
cggttgctcaacgaatatggctggtataacctaggccttggtgcatggataaagtcaaga
cgtattagggataatgggttccaagaggttgctctgcgcgttctagtatggagtggagtt
gtaggcgaagcctcgcgtataaaaggtggcatcgatcaagtcttgaattatcaagggcgt
gaatatcgttttgtatttgggcctggagatgtaaaagccgatgcagcctactatcaacat
aggtgtaaaagcagctactgtatagagcacgacgatatagtgtcccttcttcccgagaag
cctaagccactcatagttatcgacctggcacaactacacatgcataatctggatgaggct
tcaagccttagacgacagttggcagccacgctcggtgtgattaggagattcctatgggat
cgtcatctattgttgacgaatgccgctgagggtgtacgtgcatggttaaagagtttcatg
gcaaccatgcaggtgcaaatgagtagcctgaacacggatgatgctctagacgttagaggg
tatactgggttaaggatactacttgaccctaatgccgacaaagatttgcaacccgatgag
gtggttaaggccgatgttttcatactaggtggcatagtggataagaggcctaggcctgga
gctactcgcgaactaccgatagaaggtgctgtgagacgcaggatatcgcttcgcggaagc
attataggagttcctcatactatcaacacgctcgtcgaggcccttctacttgcgcgctac
gtttacgatggtaatattgaaagggcattatacgatgtcacgcctccccatgaggcccgc
ataagagcgtatgttgaaatatcacgtgttattcgtggagctaagggcgcttatgttgac
tgggacttgtatgaggagcttgttaagtggctacctctacgcccacgagatttcgaaaag
gctgctagaatggctggcgcacgattaagaaggagttacgaggagtacctgctcagcaaa
gaccaatctcatcactag

DBGET integrated database retrieval system