KEGG   Pyrolobus fumarii: Pyrfu_0662Help
Entry
Pyrfu_0662        CDS       T01620                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
pfm  Pyrolobus fumarii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pyrfu_0662
   01230 Biosynthesis of amino acids
    Pyrfu_0662
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pyrfu_0662
Enzymes [BR:pfm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     Pyrfu_0662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(609421..611370)
Genome map
AA seq 649 aa AA seqDB search
MQTYRVIEVDVSTGSWRLVEHPLGEILGPVDLGIEVHYRDETWRCDPLAPCNTLVLGLGP
FTGSPLFGSNRGVAVFRSPLSRTLHVSTVGGIGYKMRGMGAHAIVIRGAAKEPSVLIIEG
DETGVKRVTVEALGTDVWRVYGKCGVYSLAGHLIAEHRDLFKTLKPVVLVAGPASLTTRA
GAIVAVHYDPVTLEVIRGFVDVAGRGGPGTVMARAHGIVGIVAGGTWRPESINPRLSNRK
LIESIARSVAGEPYGKLVTEKTRKYRFDERLGTGGTFGVNYVHYRDLIPMLGYASVYLEK
VARLKLYEAVAEYFWKPFQEEAGTNPKKWRTCGEPCPANCKKLVKGTKVDYEPFNALGPF
SAIIVFEETRRLVELADEAGVDAIEAGYWVAWVLELAARGVIEPRDACLDERPCWDPILL
AEKPRECSARNARLARIILEKILHEGGRGCPVLQLIAERGLRGAARELAERLDTDPRSYT
VYAAFGEEGYMTLNLYWTPGLVAPVYVTGKYWTNYSPTFMEPEEFAKTAYERIINEYLVD
NAGFCRFHRGWLEKLIQAMYREILGVDKNLREHARRMYARIALYSRLAKAEPSHWETART
RDLVATIAAETGHTQWAERMVKDPRAALDWWERFKRELDKQIGVMQQDA
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaacctaccgtgttatagaggttgacgtctcgaccggctcctggaggctggtcgag
caccctctcggcgagatactaggcccggtcgacctgggcatcgaggtgcactatagggat
gagacgtggaggtgtgacccactcgccccctgcaacacgctcgttcttggcctcgggccg
ttcacaggctcgcccctcttcgggtcgaacaggggtgtcgcggtattcaggagcccactg
tcacgcactctccatgttagtacggtaggcggcataggctacaagatgaggggtatgggg
gcgcacgctatcgtcatacgaggggcggccaaggagcccagcgtgctcatcatagagggt
gacgagactggagtcaagcgtgtcaccgtagaagcgctcggaaccgacgtgtggagggtg
tacggcaagtgcggggtatactccctggctgggcacctgatagccgagcaccgcgacctc
ttcaagaccctgaagcctgttgtgctggtcgcggggcccgcctccctaacaacacgcgct
ggcgcgatagtagccgtgcactatgaccccgtcacgctcgaggtcatccggggctttgtg
gacgtcgctgggaggggcggccctgggacagtgatggcacgtgcccatggcatagtgggt
atcgtggcgggtggcacgtggcgccccgagtccatcaacccgcgactatcgaaccgcaag
ctcatagagagtatcgcacggagtgtagccggcgagccctacggtaaactagtcaccgag
aagaccagaaagtaccgctttgacgagaggctcggcaccggaggcacctttggcgtcaac
tacgtgcactaccgcgacctaatccccatgctgggctatgcgagcgtctacctcgagaag
gtggctcgcctcaaactatacgaggcggtcgccgagtacttctggaaaccgttccaggag
gaggcgggcacgaacccaaagaagtggaggacgtgcggcgagccatgcccggctaactgt
aagaagctagtgaagggcacaaaggtggactacgagcccttcaacgccctggggccattc
tcggcaatcatagtcttcgaggagacgcggcgcctcgtagagctagccgacgaggccggc
gtagacgccatcgaggccggctactgggtggcgtgggtcttggagctcgcagccaggggt
gtcatagagccgcgagacgcctgcctagacgagaggccctgctgggaccccatactacta
gccgagaagccacgcgaatgctcggcgaggaacgccaggctcgccaggatcatactcgag
aagatcctccacgagggaggccgcggttgcccagttctacagttgatagccgagcgcgga
ctacgcggcgcggcacgagagctagccgagaggctcgacaccgacccgagaagctacacg
gtctacgcggctttcggcgaggagggctacatgaccctcaacctctactggacaccaggc
ctagtagcaccggtctacgtcaccggcaagtactggaccaactactcgccaaccttcatg
gagccagaggagttcgcaaagacagcctacgagaggataatcaacgagtatctggtggac
aacgcgggcttctgccgcttccaccgcggctggctagagaagctgatacaagcaatgtac
cgcgagatactcggagtcgacaagaacctacgcgagcacgcgaggagaatgtacgccagg
atagcactgtactcgagactcgcgaaagccgagccatcccactgggagacggccaggaca
cgggaccttgtcgccacgatagcagccgagacgggccacacccagtgggccgagaggatg
gtgaaagacccgagagcagcactcgactggtgggagagattcaagagagaactagacaaa
caaataggcgtaatgcagcaggacgcgtag

DBGET integrated database retrieval system