KEGG   Pyrolobus fumarii: Pyrfu_0709Help
Entry
Pyrfu_0709        CDS       T01620                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
pfm  Pyrolobus fumarii
Pathway
pfm00010  Glycolysis / Gluconeogenesis
pfm00020  Citrate cycle (TCA cycle)
pfm00620  Pyruvate metabolism
pfm00633  Nitrotoluene degradation
pfm00640  Propanoate metabolism
pfm00650  Butanoate metabolism
pfm00680  Methane metabolism
pfm00720  Carbon fixation pathways in prokaryotes
pfm01100  Metabolic pathways
pfm01120  Microbial metabolism in diverse environments
pfm01130  Biosynthesis of antibiotics
pfm01200  Carbon metabolism
Module
pfm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pfm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pyrfu_0709
   00020 Citrate cycle (TCA cycle)
    Pyrfu_0709
   00620 Pyruvate metabolism
    Pyrfu_0709
   00640 Propanoate metabolism
    Pyrfu_0709
   00650 Butanoate metabolism
    Pyrfu_0709
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pyrfu_0709
   00680 Methane metabolism
    Pyrfu_0709
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pyrfu_0709
Enzymes [BR:pfm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pyrfu_0709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AEM38578
UniProt: G0ED19
Position
complement(660179..661408)
Genome map
AA seq 409 aa AA seqDB search
MAAAGQTLEKKAKKKKIALTGNYAVAYAVKSCDVDVVAAYPITPQSPIVEKISEYIANGE
MDAEMIHVESEHSALSALVGASAFGARVFTATSSQGLEFMHEILYIASGLRLPIVMALSN
RALSAPLNIWNDYGDAMSARDAGWIMIFDETVQEAHDAVVIAYRIAEHPDVLLPVMITLD
GFILSHTVEPVEPVEKEEALKFAPKRPRGYRPVLDPDKPVTMGVVGTPDYYYEFKRQQAE
AMKKAVPVIDEAFRDFCKTFGRCYERVETYKMDDAEYVLISMGATFGNVRAAVDKLRKEG
VKAGGLKIKVFRPFPADLVAKYLGEGRVKAVGVLDRAVSFGAAVEGPLFMEVVTSLAVRG
IQVPLVSFVHGLGGRDIFTDEVVQMFKILMDHASRGRSATQTYYIGVRE
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcgggtcaaaccctcgagaagaaggcgaagaagaagaagattgcactgacg
ggtaactacgcagtagcctacgccgtcaaatcctgcgacgtcgacgttgtcgcggcgtac
ccgatcacgccacagagccccatagtcgagaagatctccgagtacatcgccaatggcgag
atggatgcggagatgatacacgtcgagagcgagcattccgctctctcagccctagtgggc
gcctccgccttcggcgccagggtattcactgcgacaagcagccaaggcctagagttcatg
catgagatactctacatcgccagtggtctccgcctaccaatcgtaatggcgctatcaaac
cgtgcactctccgcgccactaaacatctggaacgactacggcgatgctatgagcgctaga
gacgccggctggataatgatcttcgacgagactgtacaagaggcgcatgatgcggtagtg
atcgcctataggatagctgagcaccccgacgtgctactaccagtcatgatcacgttagac
ggcttcatattgagtcacaccgtcgagccggtagagccagtcgagaaagaggaggctctc
aagtttgcgccgaagaggcctcgcggctaccgcccggtgctagacccagacaagcccgta
accatgggtgtcgtcggcaccccagactactactatgagttcaagaggcagcaggctgag
gctatgaagaaggctgtaccggtgatagacgaggcgttccgcgacttctgtaagaccttc
ggcaggtgctacgagagggtagagacgtacaagatggacgatgcagagtacgtcctaata
tccatgggtgcaacctttggcaacgtgagagcggctgtcgacaagctgcgcaaggagggt
gttaaggctggaggccttaagatcaaggtgttccgcccattccccgcagacctagtagct
aagtacctgggcgagggtcgcgtcaaggcagtaggcgtcctagaccgtgcggtgagcttc
ggtgcggcagtggaaggcccactattcatggaggtggtcacgagcctagcagtgcgcggc
atccaggtgccactcgtgagcttcgtgcacggtctaggcggtcgcgacattttcacagac
gaggtggtccagatgttcaagatactcatggaccacgcgtctcgcggtcgtagtgcaacc
cagacctactacataggtgtgcgtgagtaa

DBGET integrated database retrieval system