KEGG   Pyrolobus fumarii: Pyrfu_0711Help
Entry
Pyrfu_0711        CDS       T01620                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
pfm  Pyrolobus fumarii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pfm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pyrfu_0711
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pyrfu_0711
   00020 Citrate cycle (TCA cycle)
    Pyrfu_0711
   00620 Pyruvate metabolism
    Pyrfu_0711
   00640 Propanoate metabolism
    Pyrfu_0711
   00650 Butanoate metabolism
    Pyrfu_0711
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pyrfu_0711
   00680 Methane metabolism
    Pyrfu_0711
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pyrfu_0711
Enzymes [BR:pfm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pyrfu_0711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(661742..662332)
Genome map
AA seq 196 aa AA seqDB search
MRIELRWHGRGGQGAVTAAELLAIAAIEEGLFAQAFPEFGTERRGAPVVAYNRVADHPVY
EREPVLNPDYVIVLDPSLPPSIYMSGLKREGGLIVNTKKSPRELADELKAQGFEPPAIVA
TVDATEIALRNLRVPIVNTAMLGAFVRVSGVVSIETVEKVVADRFSDRPHLVQPNVKAVR
EAYESVNVEKLLVARA
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtatcgagcttagatggcacggccgcggtggtcaaggcgctgttaccgcggctgag
cttctggcaatagcggctattgaggaggggctctttgcgcaagcattccccgagtttggt
acggagaggcgtggtgcgccagtggtggcttacaacagggtggctgaccacccggtatac
gagcgtgagccggtcctaaaccccgactatgtaatcgtcttggacccttcgctgcctccg
tcgatatacatgtctggtttgaagagggagggcgggctcatagtgaataccaagaagtcg
ccccgcgagctagctgatgagctaaaggcgcaaggctttgaacctccagccatagtagcg
acggtagatgcgactgagattgctttacgcaatctacgcgttcctatcgtaaacactgcg
atgcttggcgcgtttgtgcgcgtatctggggtagtgagtatagagactgtggagaaagtt
gttgccgataggttctctgataggcctcatcttgtgcagcccaacgtaaaagccgtccgt
gaagcttacgagagtgtaaatgtagagaagctccttgtagctcgcgcttag

DBGET integrated database retrieval system