KEGG   Pyrolobus fumarii: Pyrfu_0719Help
Entry
Pyrfu_0719        CDS       T01620                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pfm  Pyrolobus fumarii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Pyrfu_0719
Enzymes [BR:pfm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Pyrfu_0719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(667325..668239)
Genome map
AA seq 304 aa AA seqDB search
MSYARTTCFSGYCWGLDESQVIVLGAPLEETTSYRPGTRFAPRAIREASAYIEYWSLRGK
LDVDEHVRFYDAGDALVEQPLEKALEAIGDAVERLSGVGKPLVVMGGEHTITLGIVEGLV
RAGYKPCMVQLDAHMDMRSEYAGRRVSHATFARLVVSEVGVPVVLAGVRGFVREELEFAR
ANHVPVIDAHRLQDESVAAVIPAVSKLIEKSVCNHLHLTLDMDVVDPGFAPGVSNPEPEG
ITPRILLDIVFEVARLAVLRGMSLSMDVVEVSPPYDAGGVTSVLAAKAIVEFAAGVVAAR
SSAR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
ttgtcatacgctcgcaccacgtgtttctcggggtactgttgggggcttgacgagtcgcaa
gtgattgttcttggcgctcccctagaggagacgacgagttatcgtccagggacgcgcttc
gcacctagagctatacgcgaggcgtcagcctacatagagtactggtctttgcgtgggaag
ctggacgtggacgaacatgtacgcttctatgacgcgggtgatgctctggtagagcagccg
ctcgagaaggccctggaggctataggcgacgctgtagagcggctatcgggtgtgggcaaa
ccgctagttgtgatgggaggcgagcatacgataacactcggtatcgttgagggtcttgta
cgcgccgggtacaagccatgcatggtgcagctggacgcccacatggacatgaggtcggag
tatgccggtagaagggtctcgcatgccacctttgcgcggctagtggtcagtgaggtgggc
gtcccggttgtgcttgcaggtgtacgtggctttgtacgcgaggagctagagttcgcccgt
gcgaatcacgttcccgtgatagatgctcacaggttgcaagacgagagtgtcgctgcagtc
ataccagcggtctctaagctcatagagaagagtgtatgtaaccatctacacttgactctc
gacatggatgttgttgacccgggttttgcgcctggagtctcgaaccccgagccggagggc
ataacaccccgcatactactcgatatcgtcttcgaggttgcgaggttagcagtcctgagg
ggtatgagcctcagtatggatgttgtcgaggtctcgccgccctacgacgcgggtggtgtg
acgtcggtactcgcggccaaagcgatagtggagttcgcagcaggagtagtagcggctagg
agcagcgctagatag

  All links  
No link information was found.   
DBGET integrated database retrieval system