KEGG   Pyrolobus fumarii: Pyrfu_0889Help
Entry
Pyrfu_0889        CDS       T01620                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pfm  Pyrolobus fumarii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pyrfu_0889
   01230 Biosynthesis of amino acids
    Pyrfu_0889
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pyrfu_0889
   00051 Fructose and mannose metabolism
    Pyrfu_0889
   00562 Inositol phosphate metabolism
    Pyrfu_0889
Enzymes [BR:pfm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pyrfu_0889
Exosome [BR:pfm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pyrfu_0889
  Exosomal proteins of bladder cancer cells
   Pyrfu_0889
  Exosomal proteins of melanoma cells
   Pyrfu_0889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
842104..842796
Genome map
AA seq 230 aa AA seqDB search
MRDVYILAVNFKVYPSAFGRRALEVVKAAERVAREFEGTVSVIIAPPHTEIARISSSVER
VIVYAQHVDPVEPGAHTGSVPVEAVKEAGARGSLVNHSERKLRLDEIERVVERLKVVGLE
QLVCADTPRAAAAIAVFEPTYVAVEPPELIGTGIAVSRAKPEVVTKAVESVTRVSPNVPV
LVGAGIVSREDARRSVELGARGVLVASAVMKAADPYAKMRELAEGLAPRR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
gtgagagacgtgtacatcttagctgtcaactttaaggtctacccgagcgcctttggtaga
agggcactagaagttgtcaaggcggctgaacgtgtagctcgcgaattcgaaggcacggtt
agcgtgataatcgctcctccacatacagagattgcaagaatatcgagtagcgttgagcgc
gtgattgtgtatgcgcagcatgttgatcctgtggagccgggtgctcatacgggtagtgtt
cccgtcgaagcggtcaaggaggctggtgctagaggctctctcgttaaccacagcgagagg
aagcttagacttgacgagatagagcgtgttgttgagaggttaaaggtggttggcctagag
cagcttgtatgtgctgatacgccgcgtgcggctgcagctatagcggtctttgagcctacg
tatgtagctgttgagccgccagaactgataggtaccggtattgcggtgtcaagagctaaa
ccggaggttgtgactaaggccgttgagagcgtgacacgggtctcgccgaacgtccctgtc
ctcgtaggcgccggtatagtgtcccgcgaggatgcgaggcgctcagtagaacttggtgcg
cggggcgtgctcgtcgcgtcggctgtgatgaaggcagccgacccttatgctaagatgcgc
gagcttgccgagggtctagcaccacgcagatga

DBGET integrated database retrieval system