KEGG   Pyrolobus fumarii: Pyrfu_0897Help
Entry
Pyrfu_0897        CDS       T01620                                 

Definition
PfkB domain containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pfm  Pyrolobus fumarii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pfm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pyrfu_0897
Enzymes [BR:pfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Pyrfu_0897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
850338..851294
Genome map
AA seq 318 aa AA seqDB search
MRIKHLSIGNINIDIYLYVERLPGPDEELPVMEASIGPGGAASNYAVGVARAGHESYLLA
HTTRDAEALGILGRLREAGVKLDYVIVHEEGTPGIVVVVVAKGGETVMFKVRGVNALLRG
DEISGEFDVVHIASVEPTVVERVTRQVSTRIISYDPGGAVAISNPSEVAKLAGRVTILSL
NAREFLHVFGLGVASVSERLDKNWMLIRLGARGSLLVSNGRALHTRVCKLGEPVDTTGAG
DAFNAYFNAWIAEGNEVEEALEVASIAAGLKVLKRGAQSIPSREEVEEVWRKGICKGIVR
RVTLEEAEQLVRETVGSS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcaagcatctctccataggcaacataaacatagacatctacctctatgtcgaa
aggctgccaggtccggatgaggaactgccggttatggaagctagtatcggtccagggggc
gcggcatccaactatgctgttggtgtcgcgcgagcaggtcatgaatcgtatctgcttgct
catacaactcgtgatgccgaggccctaggtatacttgggagactacgagaggcgggcgtc
aagctagactacgtaatcgtgcatgaagagggcacgcctggaatagtggttgttgttgta
gccaaaggcggagaaaccgtgatgttcaaggtacgcggcgtcaatgcgttactacgaggc
gatgagataagtggcgagttcgacgtggttcacattgccagcgttgaacctacggttgtc
gagagagtaacaagacaagtatccacacgtataatcagctacgatccaggcggtgcagta
gcgattagcaatccgagcgaagtcgccaaactagcaggcagagtgacgatactatcatta
aatgctagagagtttctacacgtcttcggtctcggcgtggcaagcgtctcagagaggcta
gataagaactggatgttgatccggctcggtgccagaggatcgcttctagtgagtaatggt
agagccctacacacccgagtctgtaagctcggcgaacctgtagacaccacgggtgcaggc
gacgcgttcaacgcatacttcaacgcgtggattgctgagggtaatgaggttgaagaggcg
ttggaagtggctagtatagcggctggtttgaaagtgttgaagcggggtgcacagagtata
cctagtcgcgaggaggttgaggaagtatggcgcaaagggatatgcaaagggatagtgagg
cgcgtgacgctagaagaggcggaacagctggtgagagagacagttgggagcagctag

DBGET integrated database retrieval system