KEGG   Pyrolobus fumarii: Pyrfu_0975Help
Entry
Pyrfu_0975        CDS       T01620                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pfm  Pyrolobus fumarii
Pathway
pfm00010  Glycolysis / Gluconeogenesis
pfm00620  Pyruvate metabolism
pfm00640  Propanoate metabolism
pfm00680  Methane metabolism
pfm00720  Carbon fixation pathways in prokaryotes
pfm01100  Metabolic pathways
pfm01110  Biosynthesis of secondary metabolites
pfm01120  Microbial metabolism in diverse environments
pfm01130  Biosynthesis of antibiotics
pfm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pyrfu_0975
   00620 Pyruvate metabolism
    Pyrfu_0975
   00640 Propanoate metabolism
    Pyrfu_0975
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pyrfu_0975
   00680 Methane metabolism
    Pyrfu_0975
Enzymes [BR:pfm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pyrfu_0975
Lipid biosynthesis proteins [BR:pfm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pyrfu_0975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEM38843
UniProt: G0EEM1
Position
complement(921294..923264)
Genome map
AA seq 656 aa AA seqDB search
MTSEPKTLPTEARFIPKRLEEVRKRALENPEEFFAEIARELEWFKTWDKVLDDSNPPFYR
WFVGGLINASYNAVDRHLKRGLRNKAAIIWEGEPGDTRVLTYYQLYREVNRFAAVLENLG
LRKGDTIAFYLPMIPELPIFMLAAARLGITFTVVFSGFSAKALAERINDAKAKVLVTADG
GFRRGKVIELKKIADEALEMAPSVETVIVVKNVTARGAKIDVPLTEGRDYWLHNLLPAHA
KVDPVPVESTHPLFILYTSGTTGKPKGVVHSTGGYLVWVYATMKWVFDVKPDDVMFCTAD
IGWITGHSYVVFGPLLHGITTVMYEGAPDYPAPDRWWQIVEKYGVTIFYTAPTAIRMLMR
YGEEWVKKHDLSTLRILGTVGEPINPEAWKWYYTVVGGERCPIVDTWWQTETGGIMISPA
PGIQLVPLKPGSATYPLPGVDADVVCEDGSPCPPGQRGYLVIKRPWPGMLMTLWGDPERY
VRTYWQRFSKPEEGKWIYYPADYAMKDEDGYFWILGRADEVIKVAGHRLGTAEIESALVS
HPAVAEAAVVGKPDPVKGEVPVAFVVLRQGYTPSEELRHELVEHVRKTLGPIAVPAAIFF
VEKLPKTRSGKIMRRVIKAVLLGKTPGDLTTLEDEASLDEIRRALEEFKRELEKAE
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
ttgacctcagagcctaagacactccccacagaagccagattcatccccaagaggctcgaa
gaggttagaaagagagcccttgagaacccagaggagttcttcgcagaaattgccagagag
cttgaatggttcaaaacctgggataaggtgcttgatgatagcaacccgccattttaccgt
tggttcgtcggcggtttgataaacgcgagttataacgctgtagaccgtcacctgaaacgc
ggtctacgcaacaaagccgcaataatatgggagggtgagcctggcgacacgcgtgtcctc
acatactaccagttgtaccgtgaggtgaaccgcttcgctgctgttctcgagaaccttggt
cttaggaagggcgataccatcgcattctatttgccgatgataccagagcttccaatattc
atgctggcagctgctagacttggtataacgtttacagttgtgtttagcggcttctctgca
aaggcccttgcagagaggatcaatgatgcgaaggcaaaggtgctcgtaactgcagatggc
ggctttagacgcggcaaggtcatcgaactgaaaaagattgcagacgaggctctagagatg
gctcccagtgttgagacggtcattgtagtcaagaatgtgaccgctagaggcgctaagata
gacgtgccgctgactgagggtcgcgactattggcttcataacctactaccggcgcacgcc
aaagtcgaccccgtgccagtggaatctacgcacccattgttcatactatacactagtggc
acgactggcaaaccaaagggcgtggttcacagcaccggtggctaccttgtatgggtctat
gcgaccatgaagtgggtctttgacgtgaaaccagatgacgttatgttctgtacagccgat
atcgggtggataacgggccatagctatgtagtgtttggcccgttgcttcacggcataact
acagtcatgtatgagggtgcaccggactaccctgcacctgaccgttggtggcagatagtc
gagaagtatggcgttacgatattctacaccgcgccaaccgcgataaggatgctaatgagg
tatggtgaagagtgggtcaagaagcacgacctctcaacgctccgtatactcggcacggtc
ggcgaaccgatcaacccggaggcgtggaagtggtactatactgtagtcggcggagagaga
tgccccatcgtcgacacatggtggcagacagaaaccggaggcatcatgatatcgccggcg
ccaggcattcagcttgtacccttgaagccggggagcgccacataccccctgccaggcgtc
gatgcagacgtcgtatgcgaggatggcagcccctgtcctcccggccagcgtggctacctg
gtaatcaagaggccttggccaggaatgctcatgacgttatggggcgaccccgagaggtac
gtaaggacgtactggcagaggtttagtaagccagaggagggcaagtggatctactatcct
gcagactacgcgatgaaggatgaggatggatacttctggatactgggtagagcagacgaa
gtgatcaaagttgctggtcataggcttggcaccgccgagatagaaagcgccttagtaagc
caccccgcggtggccgaggccgctgttgttggaaagccggacccggttaaaggcgaggta
ccagtggcattcgttgtactaaggcaaggttacacgccaagtgaggagctacgccacgag
ctagtagagcatgtgagaaagacacttggaccaatagctgtgccagcagcgatattcttc
gtcgagaagctgcctaagacaagaagcggaaagataatgaggagagtgataaaggcagtg
ttgctcggcaagacccccggcgacctaaccactctcgaggatgaagctagcctcgacgaa
atacgaagagcacttgaggagttcaagagggagcttgaaaaggctgagtaa

DBGET integrated database retrieval system