KEGG   Pyrolobus fumarii: Pyrfu_1023Help
Entry
Pyrfu_1023        CDS       T01620                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pfm  Pyrolobus fumarii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pfm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pyrfu_1023
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pyrfu_1023
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pyrfu_1023
Enzymes [BR:pfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pyrfu_1023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
965622..966380
Genome map
AA seq 252 aa AA seqDB search
MTLPRPGFSAYITIGWPNPGTFEKLVETLSECVDFFEFGVPTPRPIYDGPTIRETHAEAL
KSVSGWRDALKLLSRLEIGDKRPTIIMAYMSDHLGHLREFHEEAASAGARCILYPDLPFE
HPEKLWLYVDESERVGLKPCFFASSRFPHRWLLTYAALRPLFIYLGLQPATGVKLPIAVE
KNVRLAKKLVGDVYLLAGFAIRDSETARRLIEVGADAVVVGSAIIRAAKDRGLDEAKRLA
CSIHQAVHAERA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
ttgacactcccgaggcccggcttctcggcctatatcaccatagggtggcctaaccccggt
acattcgagaagctagtggagactctatccgagtgtgtagacttcttcgagttcggcgta
ccaacgccaaggccaatttacgatggtcctactatccgagagacgcacgccgaggcgttg
aagagtgttagtgggtggagggatgctctaaagctgttatccaggctagagattggagat
aaacgcccgaccataatcatggcgtatatgagcgaccatcttggtcatctccgcgagttc
cacgaggaggcggcatctgcgggtgcgcgctgcatactgtatccggatctacccttcgag
caccctgagaagctatggctgtatgttgacgaatcggaaagggttggactaaagccatgc
ttcttcgcttccagcaggtttcctcaccgttggctgctcacgtatgctgcgctgaggcca
ctcttcatctaccttggtctacagccggccaccggcgtgaagctgccaatcgctgtagag
aagaacgtaaggctagctaagaagctggtaggcgacgtataccttctcgctggtttcgca
atacgcgattctgagacggccaggaggctaatagaggttggtgctgatgctgttgtggta
ggctcggctatcataagagccgcgaaggacaggggccttgacgaggcgaagagattggca
tgcagtatacaccaggcggtgcacgcggagagagcgtag

DBGET integrated database retrieval system