KEGG   Pyrolobus fumarii: Pyrfu_1085Help
Entry
Pyrfu_1085        CDS       T01620                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pfm  Pyrolobus fumarii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pfm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pyrfu_1085
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pyrfu_1085
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pyrfu_1085
Enzymes [BR:pfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pyrfu_1085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1026177..1027466)
Genome map
AA seq 429 aa AA seqDB search
MVDVPSRWYNIVADLPVPLPPLIDPLDDEGSRIQLLVRILPSRLIDEEYTLSRFLDIPDE
VRAAYRKVGRPTPLIRAEGLEKALGVHGRVRIYYKFEGALPTGSHKINTAIPQVYYAKLD
GANEVATETGAGQWGLAVATAAAILGMKATIFMTRSSYHSKRQRRLLMQLLGATVHPSPS
EVTEAGRRALRENPEHPGSLGLAITEAVEYVLSSNDRRYVAGSVLESVLTHQTVIGMEVL
EQLPEEPDYMIACVGGGSNMGGFSYPALGMKLRSEGFEKTRFIAAEATAVPRLSKGEYRY
DGLDTGLVLPLAKMYTLGKDYVPPPIHAAGLRYHGAAPSLSLLRKLGYIEARAYTQEEVY
EAGKLFARSEGIIPAPESTHAIRAVIDIAKRAPQDTVIVFNLSGHGLLDTDAFEKIESRI
ISGRLPQPD
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggttgacgtgccttcacgctggtataacattgtggctgacctcccggtgccgctcccc
ccgctcatagatcctctcgatgacgagggttccaggatacagctgctggtgcgcatactc
ccatcgaggcttatcgacgaggagtacactctctcaaggttcctcgatataccggacgag
gttagggcggcttacaggaaggttgggaggccgacaccactcatccgtgcagagggttta
gagaaggcgcttggcgtgcatggaagagtgcgtatatactataagttcgagggtgcgttg
cccaccgggagccacaaaatcaacaccgcgataccccaggtgtactacgcgaagcttgac
ggtgctaacgaggttgcgaccgagactggtgccgggcaatgggggctcgccgtggctaca
gcagccgcgatactcggtatgaaagcaaccatattcatgaccaggtcgagctaccatagc
aagaggcagcgcaggctgctaatgcagcttcttggcgccacggtacacccgagcccgagt
gaggtcactgaagcagggagacgagcgctcagggagaacccggagcacccgggcagcttg
gggctcgccataaccgaggccgtggagtacgtcctgtcaagcaacgataggaggtatgtt
gctggctctgtactcgagagtgtgctcacacaccagactgtgataggcatggaggtgctg
gagcagttgcccgaagagccggactatatgatagcatgtgtaggcggcgggagcaacatg
ggcggcttctcgtaccccgctctaggaatgaagcttcgtagcgagggattcgagaagacc
agattcatagccgcagaggctacagctgtaccgaggctctcgaaaggcgagtaccgctac
gacggactagacactggcctcgtcctgccactagcaaagatgtacaccctgggcaaggac
tacgtacccccgcctatacacgctgctggactacgataccacggagccgcgccaagccta
agcctgctaaggaaactcggctacattgaagcacgtgcctatacacaagaggaggtatac
gaggcgggcaagctgtttgcacgcagcgagggtatcatcccagcaccagaatcaacccac
gccatcagagcagtcatcgatatcgcgaagagagcgccacaggacacagtcatagtcttc
aacctgagtggccacgggcttctagataccgacgccttcgagaagatagaatcgcgtatc
atatcagggaggctaccccagcccgactag

DBGET integrated database retrieval system