KEGG   Pyrolobus fumarii: Pyrfu_1379Help
Entry
Pyrfu_1379        CDS       T01620                                 

Definition
Porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pfm  Pyrolobus fumarii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pyrfu_1379
Enzymes [BR:pfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Pyrfu_1379
Exosome [BR:pfm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pyrfu_1379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1289206..1290225
Genome map
AA seq 339 aa AA seqDB search
MSFPALRPRRLRATKAIRDLVAETKLEPSDFILPIFVKEGIDKPEPIEAMPGQYRYPVGE
HLVRFVREALEVGIKAVLLFGYPRDRDEKGLVATRREGVVQEAVRLLRREFGDELVIFTD
VCICNYTVHGHCGIPVRRRKGPVEITIVDNDSTLEVIAKMAVSHAEAGADFVAPSGMMDG
MIRAIREALDREGFTDVGIMSYAVKYASGFYGPFREALHSAPRFGDRRSYQMDPRNAAEA
LKEARLDVEEGADILMVKPALAYLDVISLVKEAFPDYPLAAYNVSGEYSMVKAAAEKGWI
DERIVTLEILTAIKRAGADIIITYHAIDAAKWLREGLPF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
ttgagtttccctgctctccgtccgcgtaggctccgtgctaccaaggcaattcgtgatcta
gtcgccgagaccaagctggagcctagcgacttcatacttcccatcttcgtaaaggagggt
atcgacaaaccagagcccatagaggctatgccaggccagtatcgctaccccgtaggtgag
cacctggtacgttttgtgagagaggctctcgaggtcggcattaaggcggtgctactcttt
ggctaccctcgtgaccgtgacgagaagggtctagtcgcgactaggcgggagggtgtggtc
caggaggctgttaggcttctacgtcgtgagtttggcgacgagcttgtcatctttaccgac
gtgtgcatctgtaactataccgtgcacggtcattgcgggataccggtgagaaggaggaag
ggacctgtagagatcacgattgtcgacaacgattcgactctagaggttatagcgaagatg
gctgttagccacgctgaagcgggtgctgatttcgtagcgcccagcggcatgatggatggc
atgatacgcgctattcgcgaggcccttgaccgagaggggttcaccgacgtgggcataatg
agctatgccgtgaagtacgcctcggggttctatggaccgttccgcgaggcgctgcactca
gcgcctcgttttggcgaccgtaggagctaccagatggacccgaggaacgctgcagaggcc
ctcaaggaggctagactcgacgtcgaggagggcgcagacatcctcatggttaagcctgct
ctcgcatacctggatgtcataagcctggttaaggaggcgttcccggactacccgctagcc
gcctataacgtgagcggcgagtactcgatggtgaaggctgctgcggagaaaggctggata
gacgagaggatagtgacactcgagatactaacagctatcaagagagccggagccgacatc
ataatcacctaccacgcgatagacgcggctaagtggttgcgcgagggcctccccttctaa

DBGET integrated database retrieval system