KEGG   Pyrolobus fumarii: Pyrfu_1383Help
Entry
Pyrfu_1383        CDS       T01620                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pfm  Pyrolobus fumarii
Pathway
pfm00860  Porphyrin and chlorophyll metabolism
pfm01100  Metabolic pathways
pfm01110  Biosynthesis of secondary metabolites
pfm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pyrfu_1383
Enzymes [BR:pfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Pyrfu_1383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Nitro_FeMo-Co GST_N_2
Motif
Other DBs
NCBI-ProteinID: AEM39241
UniProt: G0EGU3
Position
1293255..1293977
Genome map
AA seq 240 aa AA seqDB search
MNCKVHVLLLRPADEPPPKRFDERLVISHIPLLDWEVIEDSVEKLKELLKDVEWLVYTSF
RGVRATSKLAGLIREHVAKGKLRLAAVGPRTAEEVKSVIGVEPDLVPREYRGAVLAEELL
DAGAHRVLFARSEKGLPEPVEVLRQHGVIVYDVPVYRMVVLERMVEAAVRAAPLYDYVVF
TSPSIVEAFTSKWRGDTLRAVAIGPTTAARLRKAGIEPLLVPREYTLEALLREILSASCG
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
ttgaactgcaaggtacacgttctcttactgcgtccggctgacgagccgccaccaaagagg
tttgacgagaggcttgtaatctctcacattcctctcctcgactgggaggttatcgaagac
agcgttgagaagctaaaggagctgctgaaggatgtggagtggctcgtctatacgagtttc
cgaggtgtcagagccacttcaaagcttgcggggcttatccgcgagcacgtagctaagggt
aagctgcgattagctgctgttggcccgcggaccgccgaggaggttaagagcgttataggt
gtagagccggacctcgtgccacgtgaataccgcggtgctgttctcgcggaggagcttctc
gatgccggcgcacatcgtgtactgttcgcacgctctgagaagggtctaccggagcccgtg
gaagtacttagacaacacggtgtaatcgtctatgatgtgcccgtgtaccggatggtcgta
ttggagcgcatggtcgaggctgctgtaagggccgcacccctgtacgactatgttgtcttc
acgagcccgagcatagttgaggcgtttacatctaagtggcgtggtgacacacttagagcc
gtggccattgggcccaccaccgctgctaggctgaggaaagcgggtatcgaaccgctccta
gtacctcgcgagtatacgctagaggcgcttcttcgtgagatactctcggcttcttgtgga
tga

DBGET integrated database retrieval system