KEGG   Pyrolobus fumarii: Pyrfu_1411Help
Entry
Pyrfu_1411        CDS       T01620                                 

Definition
CoA-binding domain containing protein
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
pfm  Pyrolobus fumarii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pyrfu_1411
   00620 Pyruvate metabolism
    Pyrfu_1411
   00640 Propanoate metabolism
    Pyrfu_1411
Enzymes [BR:pfm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     Pyrfu_1411
Lipid biosynthesis proteins [BR:pfm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pyrfu_1411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1316227..1317588
Genome map
AA seq 453 aa AA seqDB search
MAVVGASRNPRKVGHIILRNILEYGFRGRVYPVNPHASTILGLRAYPSLTSLPETVDVAV
VAVPAEKVPRVVQDAGEAGIPFLVIVSSGFREVGRHDLEEEVLRIARKYGVRIIGPNVAG
IVYTPARLNATFGPRDVIPGSIAFISQSGAFAIALMGATINEGMGVSAIVSVGNKVDIDD
VDLLEYFETDSNTSVVLMYVEGLRDGRRFLRVASKVSLRKPVIIIKAGRTEAGAKAAASH
TGSLAGSFDVYRAAFRQSGVLLATSMEEAFDAAKAFAWNPLPRGDRVLVITNGGGAGIQA
VDTLVERRIRVEEPPTELQDRMKSFLPNFASTRNPIDLTGMAHADWFYRAIKEAMRHPWV
DAIVVLYTQTGLSGPVETAKAILDAIREEGHAKPVTVGLLGGPECIRAARLLTKERVAAY
PTPERAANAMSFLVEYVRLRDYVKERLSELQYA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
gtggcggttgtgggagcttcacgcaacccgaggaaggtcggtcacattatcctccgaaat
atactcgagtatggtttccgcggccgcgtctaccctgtaaacccccacgcttctaccata
ctaggtctccgtgcgtacccgagcctaacctcactaccggagactgtggacgtcgctgta
gtcgcggtgccagctgaaaaggtacctagggttgttcaagatgccggtgaggctggcatc
ccgttcctagtgatagtatcgtccgggttccgcgaggtaggccgacatgacctcgaagaa
gaggttctgaggatagcgagaaagtatggagtgaggataatcgggcccaacgtcgcaggc
atagtctatacacctgcgcgtctgaacgccacctttggcccacgtgacgtcatcccaggc
tctatagccttcatatcgcagagtggcgcctttgcgatagcactcatgggcgcgacgata
aacgagggtatgggggtttcggctatagtgagtgtagggaataaggtggacatcgacgat
gtagatctcctagagtatttcgagactgacagcaacactagcgtggttctcatgtacgtg
gaggggttgagagacgggaggcgttttctcagggtagcttcaaaagtgtcgctaagaaag
ccagtgattatcataaaggctgggaggacggaggctggcgccaaggccgccgctagtcat
actgggagtctcgccggcagcttcgacgtctatagggccgcgtttcgacaatctggtgtc
ctcctagcaactagcatggaggaggcgtttgacgctgcaaaagcatttgcgtggaacccg
ctaccccgcggcgacagggtcttggtgataactaatggtggcggtgcggggatacaagct
gtcgacacgctagtagagcgccggatacgcgtcgaggagccaccaacagagctccaggat
aggatgaagagcttcctgccaaacttcgcctcgactaggaacccgatagatttgactggc
atggcgcacgccgactggttctatagggcgattaaagaggccatgagacacccttgggta
gacgctatagtggtgctatacacccagactggattatcagggcctgtagagactgcaaaa
gcgatactagatgccatacgcgaggagggccacgcgaagccagttactgtgggtctgctt
ggcggcccggagtgcatacgtgcagctagactactgacgaaggagagggtagccgcatac
ccgacccccgagagagccgcaaatgccatgtccttcctggtagaatacgtgaggctccgt
gactatgtaaaagagcggctatcggagttgcaatacgcttaa

DBGET integrated database retrieval system