KEGG   Pyrolobus fumarii: Pyrfu_1421Help
Entry
Pyrfu_1421        CDS       T01620                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pfm  Pyrolobus fumarii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pyrfu_1421
   00030 Pentose phosphate pathway
    Pyrfu_1421
   00051 Fructose and mannose metabolism
    Pyrfu_1421
   00052 Galactose metabolism
    Pyrfu_1421
   00500 Starch and sucrose metabolism
    Pyrfu_1421
   00520 Amino sugar and nucleotide sugar metabolism
    Pyrfu_1421
  Nucleotide metabolism
   00230 Purine metabolism
    Pyrfu_1421
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pyrfu_1421
Enzymes [BR:pfm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Pyrfu_1421
    5.4.2.8  phosphomannomutase
     Pyrfu_1421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1324245..1325633
Genome map
AA seq 462 aa AA seqDB search
MGCCILGRLFGTDGVRGVVNRELTVELALKLGLAIGTWFGTGSRILVGRDVRVGGDALMH
AVIAGLEAVGCKVYVAGLAPTPAIQYAVRKHGFDGGVIVTASHNPPEYNGVKVVGSDGVE
IPREAEREIEEIFFGSRWRYASWKSFVWEAKPWPNVIEDYVDAVASMVDDEAIRRRGFRV
VVDAANSVGTLATPRVLQKLGVKVYTVNSDLNPLFPGREPEPTPDTLRETRRIVAELNTD
LGVGHDGDADRAIIIDEKGEAWWGDRTGALLAAHVSERHPELPKRVFTGVSSSTLVEEYL
SRFNIEVRWTPVGSVVISRMLIREGGIAGFEENGGYMHPLHQPVRDGAMTTALFLELMAH
EGVKASELFDRLPKYYAVKTKVPMPREKAVEVVNEVKKHFSGQRMVTIDGVKVFGDGWWF
LVRPSGTEPVLRIMVEARSPEEAKRLAEELKKLVEEIARSKA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
ttggggtgttgcatcctgggcaggctcttcggcacagacggtgtacgcggtgttgtgaac
cgcgaactcaccgttgaactggctttgaagctcggccttgctatcggcacatggtttggt
accggttcacgcattctagttggtcgcgacgtgcgtgtgggtggcgatgctctaatgcat
gctgtcatagctggtctcgaagctgtaggatgtaaggtgtatgttgctggcttggcacct
acaccagctatccaatacgctgtccgaaagcatggttttgacggtggcgttatagtcacc
gctagccacaacccgccagagtacaacggcgtcaaggttgtcggttcggatggtgttgag
atcccacgcgaggctgagagggagatagaggagatattcttcggttcacgctggcggtac
gcctcgtggaagagcttcgtatgggaggccaagccgtggcctaacgtcatagaggattac
gtggatgctgttgcatcgatggtcgacgacgaggctatacgtaggcgtggtttccgcgta
gttgttgacgcggcgaatagcgttggcacactagccacaccaagagtccttcagaagctg
ggagtcaaggtctacaccgtgaacagcgacctaaacccgctcttcccgggcagggagccc
gagccgacaccagatacactacgcgagactagacgcatagtagcagagctcaacacagac
ctgggcgtgggccacgatggtgatgcggaccgcgcaatcataatcgatgagaagggtgaa
gcctggtggggcgaccgtaccggcgcgctcctagctgctcacgtatccgagcggcatcca
gagcttccaaagagggtgtttaccggcgtatcttcaagcacgctggtcgaggagtaccta
tcgaggttcaacatagaggttcgctggacacccgtggggagcgtagtgatatccaggatg
ctgattagagagggtggtatagccgggtttgaggagaacggcggctacatgcacccgctc
caccaaccggtaagagacggggcaatgacaacagcattgttcctcgagctcatggcgcac
gagggtgtgaaggcatccgaactcttcgacagattaccaaagtactacgctgtaaagaca
aaggtgccgatgccacgtgagaaggcagtagaggtcgtcaacgaggttaagaagcacttc
tctggccaacgtatggtgacaatcgacggcgtcaaggtgtttggcgacggatggtggttc
cttgttagaccctctggtacagagcctgtgctcaggataatggtggaggctaggagtccc
gaggaggctaagaggctcgcagaagagttgaagaaactcgtagaggagattgctaggagt
aaggcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system