KEGG   Pyrolobus fumarii: Pyrfu_1518Help
Entry
Pyrfu_1518        CDS       T01620                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pfm  Pyrolobus fumarii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:pfm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Pyrfu_1518
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pyrfu_1518
Enzymes [BR:pfm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Pyrfu_1518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1422548..1423486)
Genome map
AA seq 312 aa AA seqDB search
MGTFKGRDVISILDFNREELEMLFEEADRFERMLHEGHVPRLLEGRILALAFFEPSTRTR
LSFEAAMKRLGGETIGFTSEEAISVAKGESFADTIRMLDAYADAIVVRHKFEGAALYAAE
VAEHPVINAGDGKQHHPTQAMLDLYTVRKLFGSPDGLVYGVLGDLRYSRAAISFLYGLTL
FKPRMVYLISPPQLRVREEVREVLRERGLKMQEVERLEDVIQELDVLYVVRIQRERFPDP
MEYERVRGSYRVTPDIVSKGKDTLRVLHPLPKVDEIDPRVDTMPQAAYFYQARLGVPLRM
ALLYLILGGEKA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgggcacgtttaaaggccgtgatgttatcagcatactggacttcaaccgcgaagaactc
gagatgttattcgaggaggctgatcgtttcgagaggatgttgcacgagggtcatgtgccg
cggctactggagggtcgtatacttgctctcgctttctttgagccatctactcgtactcga
ttgagcttcgaagcagctatgaagagacttggcggcgagacaatagggtttacctctgaa
gaggcaattagtgttgccaagggggaatcattcgctgataccatcaggatgctcgacgcg
tatgctgatgctatagttgttagacataagtttgagggtgcagcactatatgcggctgag
gttgcagaacatcccgtcataaacgctggtgacggaaaacaacatcatccgacgcaagct
atgctcgacctatacacggttagaaagctattcggtagtccggacggacttgtttatggt
gtgcttggcgaccttcgatatagtagagccgctattagcttcctatatggtttgacgctg
ttcaagccacgcatggtttaccttatctcgccgccacagcttcgcgttcgtgaagaggtt
cgtgaggtgctgcgcgaacgtggattgaaaatgcaagaagttgagaggctcgaagatgtg
atacaagagcttgatgttctctacgttgtccggattcagcgcgagagattcccagacccc
atggagtatgagagagttcgaggcagctaccgtgtaactccagatattgtgtcgaaaggt
aaggatacgctacgtgtgctccaccctctaccgaaggttgatgagatagacccgcgtgtc
gacactatgcctcaagcagcctatttctaccaagctagacttggtgtacccctacgcatg
gcacttctctatctcatactcgggggtgagaaggcgtga

DBGET integrated database retrieval system