KEGG   Pyrolobus fumarii: Pyrfu_1596Help
Entry
Pyrfu_1596        CDS       T01620                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pfm  Pyrolobus fumarii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pyrfu_1596
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pyrfu_1596
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pyrfu_1596
Enzymes [BR:pfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pyrfu_1596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1487859..1489112)
Genome map
AA seq 417 aa AA seqDB search
MALWMFRRGVVLRCVNCGEIYEPDPFLFKCRKCGSLLEVLVPVEGVSWSSFRGRGVWRYR
PLLPVSDDVKPVTMGEGGTPLIRCENIEAWLRDRYGVAPRVYVKFEGANPTGSFKDRGMT
VIASIARSLRVKLVAAASTGNTASSAAAYTARAGLKMVLVLPKGKVAKGKLGQSILYGAT
IIEVDGSFDDAMKAVQDAVEASKGGIYPFNSFNPWRLEGQKTIAFEIAEEIGVPDFVIVP
VGNGGNISAIWKGFNELHKAGLIDKLPRMVGVQAEGAAPLATAFEKGLDKPLFVDKPETV
ATAIRIGRPVNWMKALRAVKESGGLFTKVSDDEILSAMRMLASMEGVGAEPAGASSLAGL
LKLVEDGTIGNNDTVVLVATGHALKDPDAMLRASTKMLHASSSSEAAKLLLEMAEKS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
ttggcgttgtggatgttccggcgcggcgttgtgctacgctgcgttaactgtggcgagatt
tacgagcccgatccgttcctgttcaagtgccgcaaatgtggaagcctactagaggtgttg
gtgccggtcgagggtgtatcatggtcttctttccgtggaagaggtgtttggaggtatagg
cctctgctgccagtctcggatgacgtcaagccagttacaatgggggagggggggacacca
ctcatacgctgtgagaacatcgaggcttggcttcgcgatcgttatggcgttgcaccgcgc
gtgtatgtcaagtttgagggtgcgaaccccacgggaagcttcaaggatcgtggaatgact
gtcatcgcctccatagccaggtcgttacgtgtgaagctcgtagctgctgcttcgaccggc
aacactgccagcagcgcagccgcttacaccgcgagagctgggctgaaaatggtactcgtg
cttccgaagggcaaggtggcaaagggcaagcttggacagagcatactctacggcgccacc
ataatagaggtcgatggtagcttcgatgatgcgatgaaagctgtgcaggacgctgtagag
gcaagcaaaggcgggatatacccgttcaacagcttcaatccttggagactcgagggccag
aaaacgatcgcgtttgagattgcggaagagataggcgtccccgatttcgttatagtgcct
gtcggcaacgggggcaacatatcagccatctggaaggggttcaatgagctgcacaaggca
ggtctcatagacaaactgccgagaatggtcggagtgcaggcagagggtgcagccccgctt
gcgactgccttcgagaaaggtctcgataaaccattgtttgtcgacaaaccggagaccgtc
gccacagcaatacggataggacgcccggtaaactggatgaaagctctgagagctgtaaag
gagagcggcggtctcttcacaaaagtaagtgatgatgagatactctcggctatgaggatg
cttgcctcgatggagggtgttggagccgagcctgccggcgcatcgagcctagcaggcctt
ctgaaactcgttgaggatggcaccataggcaacaacgatactgtagtgctcgtggccaca
ggtcatgcactaaaagacccggatgctatgctgagagcttccacgaaaatgctacacgct
agcagctccagcgaagctgcaaaactgctgctagagatggccgagaagagctaa

DBGET integrated database retrieval system