KEGG   Pyrolobus fumarii: Pyrfu_1708Help
Entry
Pyrfu_1708        CDS       T01620                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pfm  Pyrolobus fumarii
Pathway
pfm00790  Folate biosynthesis
pfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pyrfu_1708
Enzymes [BR:pfm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Pyrfu_1708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF PSK_trans_fac SnoaL_3
Motif
Other DBs
NCBI-ProteinID: AEM39564
UniProt: G0ECJ4
Position
1593981..1594559
Genome map
AA seq 192 aa AA seqDB search
MVPRVDKEKVEKAVRMLLEAIGEDPDREGLRETPRRVAEMLEEILGGYDTVEDYAWFTEE
SDLVVVAGIRFYSLCEHHLLPFFGVAHVAYLPKGKVIGLSKIVRIVQKYARRLQIQERMT
QQIADEVMHATGSEDVMVVTEAIHLCMAMRGVKTPAPTIVAALRGEFRRDTWLKKEVYDM
IAPFRLSRLVSL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtggtgccgcgtgttgacaaagagaaggtcgagaaggctgttcgaatgctccttgaggct
atcggggaggatccggatcgtgagggattgagagagacgccgcgtcgtgtagccgagatg
ctcgaggagatactaggcgggtatgatactgtcgaggattacgcgtggtttactgaggag
agcgacctggtggtggttgccggcataaggttctatagtctgtgcgagcatcacctgctg
ccgttcttcggtgtagctcatgtagcctacttgccaaagggtaaggtgataggcttgtca
aagatagtgcgtatcgtgcaaaaatatgcgcgtaggttgcagatacaggagaggatgact
caacagatagctgatgaggttatgcatgcaactggctcggaggacgtgatggtggttacg
gaggctatccacctctgcatggctatgcgtggcgtgaagacccctgcaccaacgatagtt
gcggcgctaagaggcgagtttaggagggacacgtggctaaagaaagaagtgtatgacatg
attgcaccgtttcgtttgtcgcggcttgtctcgctctga

DBGET integrated database retrieval system