KEGG   Pyrolobus fumarii: Pyrfu_1971Help
Entry
Pyrfu_1971        CDS       T01620                                 

Definition
(GenBank) apolipoprotein AI
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Apolipoprotein Baculo_PEP_C HflK_N
Motif
Other DBs
NCBI-ProteinID: AEM39824
UniProt: G0EDM0
Position
complement(1832045..1832227)
Genome map
AA seq 60 aa AA seqDB search
MPLPSLDELLRDARNELDREFDALKRELQHVADDVKKRRLAEVDELVNWFASELKRIGSR
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcccaagcctagacgagctgctacgcgacgccaggaacgagctcgaccgcgag
ttcgatgcactgaagagggagttgcagcacgtagcagacgatgtgaagaagaggaggctt
gccgaggtagacgagctcgtcaactggtttgcctcggagctcaaacgcataggctctagg
tga

DBGET integrated database retrieval system