KEGG   Pyrolobus fumarii: Pyrfu_1975Help
Entry
Pyrfu_1975        CDS       T01620                                 

Definition
(GenBank) hypothetical protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEM39828
UniProt: G0EDM4
Position
complement(1833803..1834042)
Genome map
AA seq 79 aa AA seqDB search
MPMAPPSRIVDVGGVYDTLGMVLWRVRMRETGRCRWREGCGAGLDCRIVRKAGMERVVRF
RHGVRGGLLGAWWYRVVSG
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
ttgcccatggcccctccctctaggatcgtagacgttggaggcgtgtacgataccctgggt
atggtgttgtggagggtgagaatgagggaaactggcaggtgtcgctggcgtgaaggatgt
ggtgcggggctcgactgtaggattgtaagaaaagctggtatggagcgtgtagtgcgtttt
agacacggcgtccgcggcggcctcctgggcgcctggtggtatcgtgtggtatcggggtga

DBGET integrated database retrieval system