KEGG   Pyrolobus fumarii: Pyrfu_1979Help
Entry
Pyrfu_1979        CDS       T01620                                 

Definition
(GenBank) hypothetical protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEM39832
UniProt: G0EDM8
Position
1838473..1838808
Genome map
AA seq 111 aa AA seqDB search
MKCYEGRLGFMGAYFDVRVETRGVDTCGDLRRLIEHVRSPDEALNIVERILEEHGGCVLV
SKDPLIVQTGDCSVRLVAQPASMLASMLYKRLVRMVEERCRSAKDAALTGA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatgctacgagggtagactgggtttcatgggtgcctatttcgacgtgcgcgtcgag
acccgtggagtggatacctgcggggatctacggcgcctcatcgagcacgtaagaagcccc
gacgaggcacttaacatcgtagagcgtatcctggaggagcatggaggctgcgtgcttgtc
tccaaggatcctcttatcgtgcaaacaggcgattgtagcgtgaggctcgttgcacagcca
gcctcgatgctggcctcgatgctctacaagcgtctcgtgagaatggttgaggagaggtgc
aggtcagccaaggatgcggcgctcaccggcgcatag

DBGET integrated database retrieval system