KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_0026Help
Entry
Pfl01_0026        CDS       T00283                                 

Definition
sulfatase
Orthology
K01133  
choline-sulfatase [EC:3.1.6.6]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Brite
Enzymes [BR:pfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.6  choline-sulfatase
     Pfl01_0026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(28518..30050)
Genome map
AA seq 510 aa AA seqDB search
MECRDHMKRKNILFIMADQMAAPMLPFYGPSPIKLPNLSRLAEQGVVFDAAYCNSPLCAP
SRFTLVSGQLPSKIGAYDNAADFPADIPTYAHYLRRLGYRTALSGKMHFCGPDQLHGYEE
RLTSDIYPADYGWAVNWDEPDVRPSWYHNMSSVLQAGPCVRTNQLDFDEEVVFKAQQYLF
DHIREDGDQPFCLTVSMTHPHDPYTIPKAFWDLYDDADIPLPTTPDQHSLDPHSQRLLKV
YDLWDKPLPVDKIRDARRAYFGACSYIDANVGKLLQTLEDCGLMDDTVIVFSGDHGDMLG
EKGLWYKMHWFEMAARVPLLISAPGQFKSGRVSAAVSTADLLPTFVELAGGSLEPNLPLD
GRSLVPHLNGQGGHDEVFGEYMAEGTVSPLMMIRRGAYKFIYSETDPCLLFDVDNDPREQ
EELSQSPQHRQLFDDFLAEARAKWDIPAIHRKVLESQRRRRFVAEALTIGKLKSWDHQPL
VDASQQYMRNHIDLDDLERKARYPQPCQNQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggaatgccgcgatcacatgaagcgcaagaacattcttttcatcatggccgatcaaatg
gccgcgccaatgttgccgttctacggcccgtcgccgatcaaactgccgaatctcagccgc
ctcgccgaacaaggcgtggtgttcgatgccgcgtactgcaacagcccgctgtgcgcaccg
tcgcgttttaccttggtcagcgggcagttgccgagcaagatcggcgcctacgacaacgcc
gccgatttccccgccgacattcccacctacgcccattacctgcgccgcctcggttaccgc
accgcgctctccggcaagatgcacttctgcggccccgatcaactgcacggttacgaagag
cgcctgaccagtgatatctacccggccgactacggctgggcggtgaactgggacgagccc
gatgtgcggccgagctggtatcacaacatgtcttcggtgttgcaggccgggccgtgcgtg
cgcaccaaccagctcgacttcgatgaagaggtggtgttcaaggctcagcaatatctgttt
gaccatattcgcgaggacggcgaccagccgttctgcctgaccgtgtcgatgactcacccg
cacgatccgtacacgattcccaaggcattctgggatttgtacgacgatgcggatataccg
cttccaacgacgccggatcagcattcactcgatccgcattcccagcgtttgctcaaggtc
tacgacctgtgggacaagccgctgcctgtggataagattcgcgacgcgcgccgtgcctac
ttcggtgcttgcagttatatcgacgccaacgtcggcaaacttctgcaaaccctcgaagat
tgtgggctgatggatgacaccgtcatcgtgttttccggtgaccatggcgacatgctcggc
gagaagggcctctggtacaaaatgcactggttcgaaatggccgcgcgggttcccctgttg
ataagtgcacccggtcagttcaaatcgggccgtgtcagcgctgccgtctccaccgccgac
ctgttgccgaccttcgtcgagctggcgggcggcagcctggaaccgaatctgccgctggac
ggccgctcgttggttccgcacctgaacgggcagggcggtcacgacgaagtgttcggcgaa
tacatggccgaaggcaccgtcagcccgctgatgatgatccggcgtggcgcgtacaaattt
atctacagcgaaaccgacccttgcctactcttcgatgtggataacgatccacgcgagcag
gaagaactcagccaatcgccacaacatcgccaactgttcgacgattttctcgccgaagcg
cgggccaagtgggacatcccggccatccaccgcaaagtcctagaaagccagcgccgtcgg
cgtttcgtcgccgaggcgctgacgatcggcaaactgaagagctgggatcaccagccgctg
gtggacgccagtcagcaatacatgcgcaaccacatcgacctcgatgacctggagcgcaag
gcccgttatccacaaccctgccaaaaccaataa

DBGET integrated database retrieval system