KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_0050Help
Entry
Pfl01_0050        CDS       T00283                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
pfo  Pseudomonas fluorescens Pf0-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(55155..57245)
Genome map
AA seq 696 aa AA seqDB search
MSDEAQRWKEKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAAEGTDRVVDQCMKEMRD
VVRTDDMDAGLAALLPRLEKAVLDSEQRRETRIEQVSTALTALVTQLQSLPLPREVAQPL
KKFAKQLDGRVSQAREMPLLLSELSGLQGKALSQLATPTEPGRPGLLQRLFGSRDSEETP
AQVAQAPAVTPSVQPEQPPVTHEAVPAPQAPVTSAEQVATAPVSPALIAAPVAEPSKAPE
PIPEDFTEPEVVAFEPARILTEAPSAPSEPEPVEPESKLQPFTPPPVFAPAVPTAINPDE
LILPGDTPPPVILDSLPLPEPIAQALAAIDPEQSEHDILYALPDSPEPSYSSVARHIEDT
LIGLLDDLTLPERHRPQAEAMRDRLKNGLNWYELLPILDDLATLMLAITDSGQHEFEAYL
QQLNERLEAFQSNLQAASEGHADNSSAARAMDTQIREQVDGLQTSVQEAADLNDLKQVLE
NHLEGLLGTMDQHQKQRDAREQEVAGRLKSLAERVAHMEQEALGYREHLEEQRQKALIDP
LTGLPNRAAWTERLEHEIAQWQQHGNTLSLAMLDLDHFKRINDNYGHLAGDKVLKIIATV
LRKRMRGNDFIARFGGEEFVLLLPATPPAVGAKLLENLRASIEACPFHFKGERVTITISM
GLAAFRPGEHSDLVLKRADQALYRAKNAGRNRVELG
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgaagcccagcgctggaaagagaaatacctcaaaagcatcgaacaacaggaa
aagctcgaacgtcgatgggacgcccggctcgacctgctgcgccgcggcctggtgcgcagc
accctggcggcggaaggcaccgaccgcgtggtcgatcagtgcatgaaagagatgcgcgac
gtggtgcgcaccgatgacatggacgccggcctcgccgccctgctgccacgcctggaaaaa
gccgtgctcgattccgagcagcgccgggaaacccggatcgagcaggtcagcaccgcactg
actgcactggtcactcaattgcaatccctgccgctgccccgagaagtggcccagccgctg
aagaagttcgccaagcagctggacggccgggtgagtcaggcaagggaaatgccgctgctg
ctcagcgaactcagcggcctgcagggcaaggccttgagtcagctggcgacgccgacggaa
ccggggcgtcccgggttgttgcagcgcctgttcggcagccgcgacagcgaggaaacccct
gctcaagtggcccaggctcctgcggtgactccgtcagtgcagccagagcaaccacccgtc
acacatgaagctgtgccagcgccgcaagcgcctgttacaagcgctgaacaggtcgccact
gcgcccgtcagcccagcgctgatcgccgcccccgtggccgaaccatccaaagctccagag
ccaatcccagaagactttacagagccggaggtggtcgcatttgagccggccagaatcctc
accgaagcgcccagcgctcccagcgaaccagaacccgtcgagccggaatcaaagctgcaa
cccttcacgcctcctccggttttcgcgccggcagtgcccacggccatcaaccccgacgag
ttgatcctccccggcgatacccctccgcccgtgatcctcgacagcctgcccctgcccgaa
cccatcgcccaggcattggccgccatcgatccggaacaatccgagcatgacattctctat
gccctgccggactcgccagagccgtcctacagctcggtcgcccgacacatcgaagacacg
ctgattggcttgctggatgacctgacactgccggagcgccaccgcccgcaagccgaagcc
atgcgcgaccggctgaaaaatggccttaactggtacgaactactaccgatcctcgacgat
cttgcgacattgatgctggccatcacagacagcggccagcacgaattcgaagcttatctg
cagcaactcaatgaacgcctcgaggcattccagagcaacttgcaggctgccagcgaagga
cacgccgacaacagctccgccgcgagagcaatggacacgcagatccgcgaacaggtcgac
ggcttgcagaccagcgtccaggaggcggcggatctgaatgatctcaagcaagtgctggaa
aaccacctcgagggcctgctcggcaccatggatcagcaccagaagcagcgcgacgctcgg
gaacaggaagtcgccggacgcctgaaaagcctggccgagcgcgtcgcgcacatggagcag
gaagcgctgggctatcgcgaacacctcgaagagcagcgccagaaagccctgatcgatccg
ctcaccggcctgcccaaccgcgcggcctggaccgaacggctcgaacatgaaatcgcccag
tggcagcagcacggcaacactctgagcctggctatgctcgacctcgatcacttcaagcgg
atcaacgacaactacgggcacctggccggtgacaaggtgttgaagatcatcgccacagtc
ctgcgcaagcgtatgcgtggcaacgatttcatcgctcgtttcggcggtgaggagtttgtc
ctgctgcttccagccaccccaccagcggtcggcgccaaactcctggaaaacctacgcgcc
tccatcgaggcctgcccgtttcacttcaagggcgagcgcgtcacgatcacgatctcaatg
ggactggcggcgtttcggccgggagaacacagcgatctggtgctcaaaagagccgatcag
gcgctttatcgggcgaaaaacgcgggacgtaaccgggtggagctgggctga

DBGET integrated database retrieval system