KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_0103Help
Entry
Pfl01_0103        CDS       T00283                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pfl01_0103
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pfl01_0103
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pfl01_0103
Enzymes [BR:pfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pfl01_0103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
105726..106958
Genome map
AA seq 410 aa AA seqDB search
MTQTSNNSDLRNGPDANGLFGSFGGRYVAETLMPLILDLAREYEAAKEDPAFKEELAYFQ
RDYVGRPSPLYFAERLTEFCGGAKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIA
ETGAGMHGVATATVAARFGLDCVIYMGTTDIERQQANVFRMKLLGAEVIPVVAGTGTLKD
AMNEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETRDQLQAQEGRLPDSLV
ACIGGGSNAMGLFHPFLDDKSVEIIGVEAAGYGIETGKHAASLNGGVPGVLHGNRTFLLQ
DDDGQIIDAHSISAGLDYPGIGPEHAWLHDIGRVQYTSVTDDEALAAFHQCCRLEGIIPA
LESAHALAEVFKRAPKLPKDHLMVVNLSGRGDKDMQTVMHHMETSKQEKH
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgacccagacttcgaacaactccgatctgcgtaacggccctgacgccaacggcctgttt
ggctcgttcggcggccgttacgttgccgaaaccctgatgccgttgatcctcgacctggcc
cgcgaatacgaagcggccaaggaagatccggcgttcaaagaagaattggcctacttccag
cgtgactatgtcggacgtccgagcccgctgtatttcgccgagcgcctgaccgagttctgc
ggtggcgccaagatctacctcaagcgcgaagagctgaaccacaccggcgcgcacaagatc
aacaactgcatcggccagatcctgctggcgcggcgcatgggcaaaaaacgcatcatcgcc
gagaccggcgccggcatgcacggcgtggccaccgccaccgtggctgcgcgtttcggtctg
gactgcgtgatctacatgggcaccactgacatcgaacgccaacaggccaatgtgttccgc
atgaagctgctgggcgccgaggtgatcccggtggtcgccggcaccggcaccctgaaagac
gcaatgaacgaagcgctgcgtgactgggtgaccaatgtcgacagcaccttctacctgatc
ggcaccgtggccggtccgcacccttatccagccatggttcgcgacttccaggcggtgatc
ggcaaggaaacccgcgatcagctgcaagcccaggaaggccgcctgccggacagcctggtg
gcgtgcatcggtggcggctccaatgccatgggcctgttccacccgttcctcgacgacaag
agcgttgaaatcatcggtgtcgaagccgccggttacggcatcgagaccggcaagcacgcg
gccagcctcaacggcggtgtaccgggtgtgctgcacggcaaccgcaccttcctgctgcag
gacgacgatggtcagatcatcgacgcccactcgatttccgccggcctcgactatccgggc
atcggccctgagcacgcgtggttgcatgacatcggccgcgtccagtacacctcggtgacc
gacgacgaagccctcgccgcattccaccagtgctgccgcctggaagggatcatcccggca
ctggaaagcgcccacgccctggccgaagtattcaaacgcgcaccgaaactgccgaaggat
cacctgatggtggtcaacctgtccggtcgcggcgacaaagacatgcagaccgtcatgcac
cacatggaaacttccaagcaggagaaacactga

DBGET integrated database retrieval system