KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_0103Help
Entry
Pfl01_0103        CDS       T00283                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00260  Glycine, serine and threonine metabolism
pfo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pfo01100  Metabolic pathways
pfo01110  Biosynthesis of secondary metabolites
pfo01130  Biosynthesis of antibiotics
pfo01230  Biosynthesis of amino acids
Module
pfo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pfl01_0103
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pfl01_0103
Enzymes [BR:pfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pfl01_0103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABA71847
UniProt: Q3KK59
Position
105726..106958
Genome map
AA seq 410 aa AA seqDB search
MTQTSNNSDLRNGPDANGLFGSFGGRYVAETLMPLILDLAREYEAAKEDPAFKEELAYFQ
RDYVGRPSPLYFAERLTEFCGGAKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIA
ETGAGMHGVATATVAARFGLDCVIYMGTTDIERQQANVFRMKLLGAEVIPVVAGTGTLKD
AMNEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETRDQLQAQEGRLPDSLV
ACIGGGSNAMGLFHPFLDDKSVEIIGVEAAGYGIETGKHAASLNGGVPGVLHGNRTFLLQ
DDDGQIIDAHSISAGLDYPGIGPEHAWLHDIGRVQYTSVTDDEALAAFHQCCRLEGIIPA
LESAHALAEVFKRAPKLPKDHLMVVNLSGRGDKDMQTVMHHMETSKQEKH
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgacccagacttcgaacaactccgatctgcgtaacggccctgacgccaacggcctgttt
ggctcgttcggcggccgttacgttgccgaaaccctgatgccgttgatcctcgacctggcc
cgcgaatacgaagcggccaaggaagatccggcgttcaaagaagaattggcctacttccag
cgtgactatgtcggacgtccgagcccgctgtatttcgccgagcgcctgaccgagttctgc
ggtggcgccaagatctacctcaagcgcgaagagctgaaccacaccggcgcgcacaagatc
aacaactgcatcggccagatcctgctggcgcggcgcatgggcaaaaaacgcatcatcgcc
gagaccggcgccggcatgcacggcgtggccaccgccaccgtggctgcgcgtttcggtctg
gactgcgtgatctacatgggcaccactgacatcgaacgccaacaggccaatgtgttccgc
atgaagctgctgggcgccgaggtgatcccggtggtcgccggcaccggcaccctgaaagac
gcaatgaacgaagcgctgcgtgactgggtgaccaatgtcgacagcaccttctacctgatc
ggcaccgtggccggtccgcacccttatccagccatggttcgcgacttccaggcggtgatc
ggcaaggaaacccgcgatcagctgcaagcccaggaaggccgcctgccggacagcctggtg
gcgtgcatcggtggcggctccaatgccatgggcctgttccacccgttcctcgacgacaag
agcgttgaaatcatcggtgtcgaagccgccggttacggcatcgagaccggcaagcacgcg
gccagcctcaacggcggtgtaccgggtgtgctgcacggcaaccgcaccttcctgctgcag
gacgacgatggtcagatcatcgacgcccactcgatttccgccggcctcgactatccgggc
atcggccctgagcacgcgtggttgcatgacatcggccgcgtccagtacacctcggtgacc
gacgacgaagccctcgccgcattccaccagtgctgccgcctggaagggatcatcccggca
ctggaaagcgcccacgccctggccgaagtattcaaacgcgcaccgaaactgccgaaggat
cacctgatggtggtcaacctgtccggtcgcggcgacaaagacatgcagaccgtcatgcac
cacatggaaacttccaagcaggagaaacactga

DBGET integrated database retrieval system