KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_0346Help
Entry
Pfl01_0346        CDS       T00283                                 

Definition
(GenBank) [ThiS-adenylate] sulfurtransferase
  KO
K03151  
tRNA uracil 4-sulfurtransferase [EC:2.8.1.4]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Pfl01_0346
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    Pfl01_0346
Enzymes [BR:pfo01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.4  tRNA uracil 4-sulfurtransferase
     Pfl01_0346
Transfer RNA biogenesis [BR:pfo03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Pfl01_0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
389897..391351
Genome map
AA seq 484 aa AA seqDB search
MKLIVKVFPEITIKSRPVRTKFIRQLAKNIRTVLRDLDPAVVVNGVWDNLELETRVTDPK
ALKEMGERLTCMPGIAHFLQIDEYPLGDFDDITEKCKQHYGDALAGKIFSVRCKRAGKHA
FSSMDVEKYVGSKLRRECGAAGIDLKQPEIEVRIEVRDKRLFVIHSQHNGIGGYPLGALE
QTLVLMSGGFDSTVAAYQILRRGLMTHFCFFNLGGRAHELGVMEVAHFIWKKYGSSQRVL
FVSVPFEEVLGEILGKVDDSHMGVVLKRMMLRAASSIAERLHIDALVTGEAISQVSSQTL
PNLSVIDCVTDKLVLRPLIVAHKQDIIDTADQIGTGDFARHMPEYCGVISVNPKTAAKRG
RVEHEEQEFDMAVLERALANARLVPIDRVIDELGQDLQIEEVSEALAGQIVIDIRHPDAA
EDDPLELAGIEVQTMPFYAVNARFKELDPTRQYLLYCDKGVMSRLHAHHLLSEGHANVRV
YRPS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaatcgtaaaagtcttccccgagatcaccatcaaaagccgacctgtccggacg
aaattcatccgccagctggccaagaacatccgcaccgtgctccgcgacctggacccggcc
gtggtggtgaacggtgtgtgggacaatctcgagctggaaacccgcgtcaccgatcccaag
gccctgaaagagatgggcgaacgcctgacctgcatgccgggcatcgcgcactttctgcag
atcgacgagtacccgctgggtgacttcgacgacatcaccgagaagtgcaaacagcactac
ggcgatgcgctggccgggaagatcttctcggtgcgctgcaagcgtgcgggcaagcatgcg
ttcagctcgatggacgtcgaaaaatacgtcggcagcaagctgcgccgtgagtgcggtgcc
gccggaatcgacctgaaacagccggaaatcgaagtccgtatcgaagttcgcgacaaacgg
ttgtttgtgatccacagccagcacaatggtatcggcggttacccgctcggtgcgctggaa
cagacgctggtgctgatgtcaggcggctttgactcgacggttgccgcgtaccagatcctg
cgtcgcggcctgatgacgcacttctgcttcttcaatctgggcggtcgtgcccacgaattg
ggcgtgatggaagtcgcgcatttcatctggaagaagtacggcagctcgcaacgcgtgcta
tttgtcagtgttccgttcgaagaagtattgggcgaaattctcggcaaggtcgacgacagt
catatgggcgtcgtattgaagcgtatgatgttgcgcgcagcgtcgagcattgccgaacgc
ctgcacatcgatgcgctggtcaccggcgaagcgatttcccaggtgtcgagccagacgttg
ccgaacctgtcggtcatcgattgcgtcaccgacaagctggtgctgcgaccgctgatcgtc
gcccacaagcaggacatcatcgacacggccgaccagatcggtaccggtgatttcgcccgg
cacatgccggaatactgcggcgtcatctcggtcaacccgaagaccgccgccaagcgtggc
cgggtcgagcacgaagagcaggaattcgacatggcggtgctcgagcgtgcgctcgcaaac
gccagactggtgccgatcgatcgggtgatcgacgaattgggccaggatttgcagatcgaa
gaagtcagcgaagcactggccggtcagatcgtcatcgacatccgccacccggatgccgcc
gaggatgacccgctggaactcgccggcatagaggtacagacgatgccgttctacgcagtg
aacgctcgtttcaaggaactggaccctactcgccagtacctgctgtattgcgacaaaggc
gtgatgagtcgcctgcatgctcaccatttgctcagtgaggggcatgccaatgtgcgcgtt
tatcgaccgagctaa

DBGET integrated database retrieval system